KEGG   Homo sapiens (human): 2235Help
Entry
2235              CDS       T01001                                 

Gene name
FECH, EPP, EPP1, FCE
Definition
(RefSeq) ferrochelatase
  KO
K01772  protoporphyrin/coproporphyrin ferrochelatase [EC:4.99.1.1 4.99.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00860  Porphyrin and chlorophyll metabolism
hsa01100  Metabolic pathways
Module
hsa_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Network
nt06011  Heme biosynthesis
  Element
N00601  Heme biosynthesis
N00602  FECH deficiency in heme biosynthesis
Disease
H00201  Erythropoietic porphyria
H01763  Porphyria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    2235 (FECH)
Enzymes [BR:hsa01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.1  protoporphyrin ferrochelatase
     2235 (FECH)
    4.99.1.9  coproporphyrin ferrochelatase
     2235 (FECH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ferrochelatase
Motif
Other DBs
NCBI-GeneID: 2235
NCBI-ProteinID: NP_000131
OMIM: 612386
HGNC: 3647
Ensembl: ENSG00000066926
Vega: OTTHUMG00000132740
Pharos: P22830(Tbio)
UniProt: P22830 Q7KZA3
Structure
PDB: 

Position
18q21.31
AA seq 423 aa AA seqDB search
MRSLGANMAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETAQHAQGAKPQV
QPQKRKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQ
EQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERD
GLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADH
ILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLV
WQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKEC
GVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTS
QQL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcactcggcgcaaacatggctgcggccctgcgcgccgcgggcgtcctgctccgc
gatccgctggcatccagcagctggagggtctgtcagccatggaggtggaagtcaggtgca
gctgcagcggccgtcaccacagaaacagcccagcatgcccagggtgcaaaacctcaagtt
caaccgcagaagaggaagccgaaaactggaatattaatgctaaacatgggaggccctgaa
actcttggagatgttcacgacttccttctgagactcttcttggaccgagacctcatgaca
cttcctattcagaataagctggcaccattcatcgccaaacgccgaacccccaagattcaa
gagcagtaccgcaggattggaggcggatcccccatcaagatatggacttccaagcaggga
gagggcatggtgaagctgctggatgaattgtcccccaacacagcccctcacaaatactat
attggatttcggtacgtccatcctttaacagaagaagcaattgaagagatggagagagat
ggcctagaaagggctattgctttcacacagtatccacagtacagctgctccaccacaggc
agcagcttaaatgccatttacagatactataatcaagtgggacggaagcccacgatgaag
tggagcactattgacaggtggcccacacatcacctcctcatccagtgctttgcagatcat
attctaaaggaactggaccattttccacttgagaagagaagcgaggtggtcattctgttt
tctgctcactcactgcccatgtctgtggtcaacagaggcgacccatatcctcaggaggta
agcgccactgtccaaaaagtcatggaaaggctggagtactgcaacccctaccgactggtg
tggcaatccaaggttggtccaatgccctggttgggtcctcaaacagacgaatctatcaaa
gggctttgtgagagggggaggaagaatatcctcttggttccgatagcatttaccagtgac
catattgaaacgctgtatgagctggacatcgagtactctcaagttttagccaaggagtgt
ggagttgaaaacatcagaagagctgagtctcttaatggaaatccattgttctctaaggcc
ctggccgacttggtgcattcacacatccagtcaaacgagctgtgttccaagcagctgacc
ctgagctgtccgctctgtgtcaatcctgtctgcagggagactaaatccttcttcaccagc
cagcagctgtga

DBGET integrated database retrieval system