KEGG   Homo sapiens (human): 224Help
Entry
224               CDS       T01001                                 

Gene name
ALDH3A2, ALDH10, FALDH, SLS
Definition
(RefSeq) aldehyde dehydrogenase 3 family member A2
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00053  Ascorbate and aldarate metabolism
hsa00071  Fatty acid degradation
hsa00280  Valine, leucine and isoleucine degradation
hsa00310  Lysine degradation
hsa00330  Arginine and proline metabolism
hsa00340  Histidine metabolism
hsa00380  Tryptophan metabolism
hsa00410  beta-Alanine metabolism
hsa00561  Glycerolipid metabolism
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
Module
hsa_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Disease
H00162  Sjogren-Larsson syndrome
Drug target
Cyanamide: D00123
Disulfiram: D00131
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    224 (ALDH3A2)
   00053 Ascorbate and aldarate metabolism
    224 (ALDH3A2)
   00620 Pyruvate metabolism
    224 (ALDH3A2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    224 (ALDH3A2)
   00561 Glycerolipid metabolism
    224 (ALDH3A2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    224 (ALDH3A2)
   00310 Lysine degradation
    224 (ALDH3A2)
   00330 Arginine and proline metabolism
    224 (ALDH3A2)
   00340 Histidine metabolism
    224 (ALDH3A2)
   00380 Tryptophan metabolism
    224 (ALDH3A2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    224 (ALDH3A2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     224 (ALDH3A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC PT-HINT
Motif
Other DBs
NCBI-GeneID: 224
NCBI-ProteinID: NP_000373
OMIM: 609523
HGNC: 403
Ensembl: ENSG00000072210
Vega: OTTHUMG00000059471
Pharos: P51648(Tbio)
UniProt: P51648
Structure
PDB: 

Position
17p11.2
AA seq 485 aa AA seqDB search
MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQE
VITVLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQ
PLIGAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDH
IFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQT
CIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQKI
AFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLA
LYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFS
HQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLV
KAEYY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggagctcgaagtccggcgggtccgacaggcgttcctgtccggccggtcgcgacctctg
cggtttcggctgcagcagctggaggccctgcggaggatggtgcaggagcgcgagaaggat
atcctgacggccatcgccgccgacctgtgcaagagtgaattcaatgtgtacagtcaggaa
gtcattactgtccttggggaaattgattttatgcttgagaatcttcctgaatgggttact
gctaaaccagttaagaagaacgtgctcaccatgctggatgaggcctatattcagccacag
cctctgggagtggtgctgataatcggagcttggaattaccccttcgttctcaccattcag
ccactgataggagccatcgctgcaggaaatgctgtgattataaagccttctgaactgagt
gaaaatacagccaagatcttggcaaagcttctccctcagtatttagaccaggatctctat
attgttattaatggtggtgttgaggaaaccacggagctcctgaagcagcgatttgaccac
attttctatacgggaaacactgcggttggcaaaattgtcatggaagctgctgccaagcat
ctgacccctgtgactcttgaactgggagggaaaagtccatgttatattgataaagattgt
gacctggacattgtttgcagacgcataacctggggaaaatacatgaattgtggccaaacc
tgcattgcacccgactatattctctgtgaagcatccctccaaaatcaaattgtatggaag
attaaggaaacagtgaaggaattttatggagaaaatataaaagagtctcctgattatgaa
aggatcatcaatcttcgtcattttaagaggatactaagtttgcttgaaggacaaaagata
gcttttggtggggagactgatgaggccacacgctacatagccccaacagtacttaccgat
gttgatcctaaaaccaaggtgatgcaagaagaaatttttggaccaattcttccaatagtg
cctgtgaaaaatgtagatgaggccataaatttcataaatgaacgtgaaaagcctctggct
ctttatgtattttcgcataaccataagctcatcaaacggatgattgatgagacatccagt
ggaggtgtcacaggcaatgacgtcattatgcacttcacgctcaactctttcccatttgga
ggagtgggttccagtgggatgggagcttatcacggaaaacatagttttgatactttttct
catcagcgtccctgtttattaaaaagtttaaagagagaaggtgctaacaaactcagatat
cctcccaacagccagtcaaaggtggattggggaaaattttttctcttgaaacggttcaac
aaagaaaaactcggtctcctgttgctcactttcctgggtattgtagccgctgtgcttgtc
aaggcagaatattactga

DBGET integrated database retrieval system