KEGG   Homo sapiens (human): 2244
Entry
2244              CDS       T01001                                 

Gene name
FGB, HEL-S-78p
Definition
(RefSeq) fibrinogen beta chain
  KO
K03904  fibrinogen beta chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04611  Platelet activation
Disease
H00222  Afibrinogenemia
H00223  Inherited thrombophilia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    2244 (FGB)
   04611 Platelet activation
    2244 (FGB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2244 (FGB)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2244 (FGB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   2244 (FGB)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   2244 (FGB)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   2244 (FGB)
SSDB
Motif
Pfam: Fibrinogen_C Fib_alpha CALCOCO1 FANCI_S2 DUF745 SF-assemblin
Other DBs
NCBI-GeneID: 2244
NCBI-ProteinID: NP_005132
OMIM: 134830
HGNC: 3662
Ensembl: ENSG00000171564
Vega: OTTHUMG00000150331
Pharos: P02675(Tbio)
CPD: C02404
UniProt: P02675 V9HVY1
Structure
PDB: 

Position
4q31.3
AA seq 491 aa
MKRMVSWSFHKLKTMKHLLLLLLCVFLVKSQGVNDNEEGFFSARGHRPLDKKREEAPSLR
PAPPPISGGGYRARPAKAAATQKKVERKAPDAGGCLHADPDLGVLCPTGCQLQEALLQQE
RPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQ
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKE
CEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYK
QGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFT
VQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDP
RKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKM
SMKIRPFFPQQ
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgaaaaggatggtttcttggagcttccacaaacttaaaaccatgaaacatctattattg
ctactattgtgtgtttttctagttaagtcccaaggtgtcaacgacaatgaggagggtttc
ttcagtgcccgtggtcatcgaccccttgacaagaagagagaagaggctcccagcctgagg
cctgccccaccgcccatcagtggaggtggctatcgggctcgtccagccaaagcagctgcc
actcaaaagaaagtagaaagaaaagcccctgatgctggaggctgtcttcacgctgaccca
gacctgggggtgttgtgtcctacaggatgtcagttgcaagaggctttgctacaacaggaa
aggccaatcagaaatagtgttgatgagttaaataacaatgtggaagctgtttcccagacc
tcctcttcttcctttcagtacatgtatttgctgaaagacctgtggcaaaagaggcagaag
caagtaaaagataatgaaaatgtagtcaatgagtactcctcagaactggaaaagcaccaa
ttatatatagatgagactgtgaatagcaatatcccaactaaccttcgtgtgcttcgttca
atcctggaaaacctgagaagcaaaatacaaaagttagaatctgatgtctcagctcaaatg
gaatattgtcgcaccccatgcactgtcagttgcaatattcctgtggtgtctggcaaagaa
tgtgaggaaattatcaggaaaggaggtgaaacatctgaaatgtatctcattcaacctgac
agttctgtcaaaccgtatagagtatactgtgacatgaatacagaaaatggaggatggaca
gtgattcagaaccgtcaagacggtagtgttgactttggcaggaaatgggatccatataaa
cagggatttggaaatgttgcaaccaacacagatgggaagaattactgtggcctaccaggt
gaatattggcttggaaatgataaaattagccagcttaccaggatgggacccacagaactt
ttgatagaaatggaggactggaaaggagacaaagtaaaggctcactatggaggattcact
gtacagaatgaagccaacaaataccagatctcagtgaacaaatacagaggaacagccggt
aatgccctcatggatggagcatctcagctgatgggagaaaacaggaccatgaccattcac
aacggcatgttcttcagcacgtatgacagagacaatgacggctggttaacatcagatccc
agaaaacagtgttctaaagaagacggtggtggatggtggtataatagatgtcatgcagcc
aatccaaacggcagatactactggggtggacagtacacctgggacatggcaaagcatggc
acagatgatggtgtagtatggatgaattggaaggggtcatggtactcaatgaggaagatg
agtatgaagatcaggcccttcttcccacagcaatag

DBGET integrated database retrieval system