KEGG   Homo sapiens (human): 2245
Entry
2245              CDS       T01001                                 

Gene name
FGD1, AAS, FGDY, MRXS16, ZFYVE3
Definition
(RefSeq) FYVE, RhoGEF and PH domain containing 1
  KO
K05720  FYVE, RhoGEF and PH domain containing 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
Disease
H00569  Aarskog-Scott syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2245 (FGD1)
SSDB
Motif
Pfam: RhoGEF PH FYVE FYVE_2 PH_2 CENP-B_dimeris
Other DBs
NCBI-GeneID: 2245
NCBI-ProteinID: NP_004454
OMIM: 300546
HGNC: 3663
Ensembl: ENSG00000102302
Vega: OTTHUMG00000021627
Pharos: P98174(Tbio)
UniProt: P98174 A0A024R9Y5
Position
Xp11.22
AA seq 961 aa
MHGHRAPGGAGPSEPEHPATNPPGAAPPACADSDPGASEPGLLARRGSGSALGGPLDPQF
VGPSDTSLGAAPGHRVLPCGPSPQHHRALRFSYHLEGSQPRPGLHQGNRILVKSLSLDPG
QSLEPHPEGPQRLRSDPGPPTETPSQRPSPLKRAPGPKPQVPPKPSYLQMPRMPPPLEPI
PPPPSRPLPADPRVAKGLAPRAEASPSSAAVSSLIEKFEREPVIVASDRPVPGPSPGPPE
PVMLPQPTSQPPVPQLPEGEASRCLFLLAPGPRDGEKVPNRDSGIDSISSPSNSEETCFV
SDDGPPSHSLCPGPPALASVPVALADPHRPGSQEVDSDLEEEDDEEEEEEKDREIPVPLM
ERQESVELTVQQKVFHIANELLQTEKAYVSRLHLLDQVFCARLLEEARNRSSFPADVVHG
IFSNICSIYCFHQQFLLPELEKRMEEWDRYPRIGDILQKLAPFLKMYGEYVKNFDRAVEL
VNTWTERSTQFKVIIHEVQKEEACGNLTLQHHMLEPVQRIPRYELLLKDYLLKLPHGSPD
SKDAQKSLELIATAAEHSNAAIRKMERMHKLLKVYELLGGEEDIVSPTKELIKEGHILKL
SAKNGTTQDRYLILFNDRLLYCVPRLRLLGQKFSVRARIDVDGMELKESSNLNLPRTFLV
SGKQRSLELQARTEEEKKDWVQAINSTLLKHEQTLETFKLLNSTNREDEDTPPNSPNVDL
GKRAPTPIREKEVTMCMRCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLVYDNNRSNR
VCTDCYVALHGVPGSSPACSQHTPQRRRSILEKQASVAAENSVICSFLHYMEKGGKGWHK
AWFVVPENEPLVLYIYGAPQDVKAQRSLPLIGFEVGPPEAGERPDRRHVFKITQSHLSWY
FSPETEELQRRWMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAALGATAEPPESPQTRDK
T
NT seq 2886 nt   +upstreamnt  +downstreamnt
atgcatggccaccgagccccggggggcgccgggccttcggagcccgaacacccggccacg
aacccgccgggcgccgctccgccggcctgtgccgactcggaccctggagcctcggaaccc
ggactgctggcgcgcaggggctcaggttcggctcttggcggcccactggatccccagttt
gtcggaccctcggacaccagcctgggcgctgctccaggccaccgggtcttgccctgcggt
cccagtccacagcaccaccgggccctgcgcttctcttaccacctggagggctcgcagcct
cggcctgggctgcaccagggaaaccggatcctggttaaaagtttgtcccttgaccctggc
caaagcctagagcctcatccagaaggtccccagcggcttcgctcagacccaggtcccccg
actgaaacccctagccagcgtccttcaccactgaagcgggcaccgggcccgaagccacag
gtgcccccaaagcccagctacctgcagatgccccggatgccccccccactggagcccatc
ccccctccaccatcacgcccactgcctgccgacccccgagtggccaagggcctggctccc
agggcagaggccagccccagttctgcagcagtatcctcactgattgagaagtttgaaaga
gagcctgtgattgtcgcctcggatagaccagtccctggccccagcccaggtcccccagag
ccagtcatgttgccacagccaacctcgcagccaccagtgccccagctccccgagggtgag
gcctcccgctgcctgtttctgctggctcctgggccccgggacggtgagaaggtgcccaac
cgggacagcggcattgatagcatcagctcgccatccaacagcgaggagacctgcttcgtc
agtgatgacgggccccccagccacagcctctgccctgggccccctgccctggctagtgtg
cctgttgccttggccgacccccaccggcctggctcccaagaggttgacagtgacctggag
gaggaggacgacgaggaggaggaggaagagaaggacagagaaatcccagtgcccctgatg
gagagacaggagtctgtggagttgactgtgcagcaaaaggtgtttcacattgccaatgag
ctcctgcaaactgagaaggcctacgtttccaggctccatctcctggatcaggtgttctgt
gcccggctgctggaagaagctcggaaccgcagttccttcccggccgacgttgtccacggc
atcttctctaacatctgctccatctattgcttccaccagcagttcctgctgcctgagcta
gagaagcgcatggaggaatgggaccgctatccacgcattggagacatcctgcagaaactg
gcccccttcctcaagatgtatggtgagtatgtgaagaactttgaccgggccgtggagctg
gtcaacacctggacagagcgctccacccagtttaaagtcatcatccatgaggtgcagaag
gaggaagcctgtggcaacctgacattgcagcaccacatgctggagcctgtgcagcgcatc
ccccgctatgagcttcttctcaaggactatctgttaaagctgccccatggctccccggac
agcaaggatgcccaaaagtctctggagctgatcgccacagcagcagagcactcgaatgct
gccatccgcaaaatggagcgaatgcataagctgctgaaggtatatgagctgttagggggc
gaggaggacattgtcagccccaccaaagagctcataaaagaaggccacatccttaagctg
tcagcaaagaatgggaccactcaagaccgatacctcatactattcaacgaccgcctcctt
tactgcgtgcccaggctgcggctccttggccagaagtttagcgtgcgggcacgcattgat
gtagatggcatggagctaaaggagagctccaacctcaatctgcctcgaaccttcctggtg
tcaggaaagcagcgctccctcgagctccaggccaggactgaggaggagaagaaagactgg
gtccaggccatcaactccaccctcctgaagcatgaacagacgctggagactttcaaactg
ttgaactcaacaaacagggaagatgaagacaccccacccaactctccaaacgtggatctt
gggaagcgggcacctacgcccatccgggaaaaggaagtcaccatgtgcatgcgctgccag
gagcccttcaattctatcaccaaacgcaggcaccactgcaaggcctgcgggcatgtggtt
tgtgggaagtgctccgagttccgggcccgcctcgtctatgacaacaaccgctccaaccgt
gtgtgcactgattgctatgtggccttgcacggggtgcctgggagcagtccagcctgcagc
cagcatacaccccagcgccggaggtccatcctggagaaacaggcctcagtggctgcagag
aacagcgtcatctgcagcttcctgcactacatggagaagggtggcaaaggatggcacaag
gcatggttcgtggtccctgaaaatgaacccttggtgctgtatatctacggagcccctcag
gatgtgaaagcccagcgcagcctgcccctcattggcttcgaggtgggaccgcccgaggca
ggggagcggcctgacagaaggcatgtcttcaagatcacccagagccacctcagctggtac
ttcagccctgagacagaggaactacagcgacgctggatggctgtgcttggccgggcgggc
cgaggggacacgttctgcccggggcccacactgtctgaggacagggagatggaggaggca
ccggtggctgctttaggagccactgctgaaccccccgaatccccccagacccgagacaag
acctag

KEGG   Homo sapiens (human): 89846
Entry
89846             CDS       T01001                                 

Gene name
FGD3, ZFYVE5
Definition
(RefSeq) FYVE, RhoGEF and PH domain containing 3
  KO
K05722  FYVE, RhoGEF and PH domain containing 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    89846 (FGD3)
SSDB
Motif
Pfam: RhoGEF PH FYVE FYVE_2 PH_13 PH_16 IQ_SEC7_PH PH_19 C1_2
Other DBs
NCBI-GeneID: 89846
NCBI-ProteinID: NP_001077005
OMIM: 617554
HGNC: 16027
Ensembl: ENSG00000127084
Vega: OTTHUMG00000021032
Pharos: Q5JSP0(Tbio)
UniProt: Q5JSP0 A0A024R252
Structure
PDB: 
2COC

Position
9q22.31
AA seq 725 aa
MESGRGSSTPPGPIAALGMPDTGPGSSSLGKLQALPVGPRAHCGDPVSLAAAGDGSPDIG
PTGELSGSLKIPNRDSGIDSPSSSVAGENFPCEEGLEAGPSPTVLGAHAEMALDSQVPKV
TPQEEADSDVGEEPDSENTPQKADKDAGLAQHSGPQKLLHIAQELLHTEETYVKRLHLLD
QVFCTRLTDAGIPPEVIMGIFSNISSIHRFHGQFLLPELKTRITEEWDTNPRLGDILQKL
APFLKMYGEYVKNFDRAVGLVSTWTQRSPLFKDVVHSIQKQEVCGNLTLQHHMLEPVQRV
PRYELLLKDYLKRLPQDAPDRKDAERSLELISTAANHSNAAIRKVEKMHKLLEVYEQLGG
EEDIVNPANELIKEGQIQKLSAKNGTPQDRHLFLFNSMILYCVPKLRLMGQKFSVREKMD
ISGLQVQDIVKPNTAHTFIITGRKRSLELQTRTEEEKKEWIQIIQATIEKHKQNSETFKA
FGGAFSQDEDPSLSPDMPITSTSPVEPVVTTEGSSGAAGLEPRKLSSKTRRDKEKQSCKS
CGETFNSITKRRHHCKLCGAVICGKCSEFKAENSRQSRVCRDCFLTQPVAPESTEKTPTA
DPQPSLLCGPLRLSESGETWSEVWAAIPMSDPQVLHLQGGSQDGRLPRTIPLPSCKLSVP
DPEERLDSGHVWKLQWAKQSWYLSASSAELQQQWLETLSTAAHGDTAQDSPGALQLQVPM
GAAAP
NT seq 2178 nt   +upstreamnt  +downstreamnt
atggagtcaggcagggggtcctcaacccctccaggacccattgctgccctagggatgcca
gacactgggcctggcagttcctccctagggaagcttcaggcgctccctgttgggcccaga
gcccactgtggggaccctgtcagcctggctgcagcaggggacggctctccagacataggc
cccacgggagagctgagtggtagcttaaagatccccaaccgggacagcgggatcgacagt
ccctcctccagtgtggctggagagaactttccctgcgaggagggcttggaggctggccca
agccccactgtactgggggcgcacgcagagatggccctggacagccaggtcccgaaggtc
accccccaggaggaggcggacagcgacgtgggtgaggaacctgactctgagaacaccccc
cagaaggctgacaaggatgccggcctggcccagcactctggcccccagaagcttctccac
attgcccaggagctcctgcacaccgaggagacctatgtgaagcggctgcacctgctggac
caggttttctgcaccaggctgacggatgcggggatccctccagaagtcatcatgggcata
ttctctaacatctcctccatccaccgcttccacgggcagttcctgctgccggagctgaag
acgcggatcacggaggagtgggacacaaacccacggctcggggacatcctgcagaagctg
gccccattcctgaagatgtacggcgagtatgtcaagaactttgaccgagccgtagggctg
gtgagcacgtggacccagcgctccccactgtttaaagacgtcgtccacagcatccagaag
caggaggtatgcgggaacctgacgctgcagcaccacatgctggagcccgtgcagagggtc
ccccggtacgagctgctgctcaaggactatctgaagaggctcccgcaggacgccccagac
cggaaggatgcggagaggtccttggagctcatctccacagccgccaaccactccaatgct
gccattcggaaagtggagaaaatgcacaagctcttggaggtgtacgagcagctgggtggg
gaagaagacattgtcaacccggccaatgaactgatcaaggagggccaaatccagaaactg
tcagccaagaacggcaccccccaggaccgccacctcttcctgttcaacagcatgatcctt
tactgtgtgcccaagctgcggctcatgggccagaagttcagcgtccgggagaagatggac
atctcaggcctccaggtgcaggatatcgtcaagccaaacacagcacatacattcatcata
acaggaagaaaaaggtccctggagctgcagacgcggacagaggaagagaagaaagaatgg
attcagatcatccaggccaccatcgagaagcacaaacagaacagcgaaaccttcaaggct
tttggtggcgccttcagccaggatgaggaccccagcctctctccagacatgcctatcacg
agcaccagccctgtggagcctgtggtgaccaccgaaggcagttcgggtgcagcagggctc
gagcccagaaaactatcctctaagaccagacgtgacaaggagaagcagagctgtaagagc
tgtggtgagaccttcaactccatcaccaagaggaggcatcactgcaagctgtgtggggcg
gtcatctgtgggaagtgctccgagttcaaggccgagaacagccggcagagccgtgtctgc
agagattgtttcctgacacagccagtggcccctgagagcacagagaagacacccactgca
gacccccagcccagcctgctctgcggccccctgcggctgtcagagagcggtgagacctgg
agcgaggtgtgggccgccatccccatgtcagatccccaggtgctgcacctgcagggaggc
agccaggacggccggctgccccgcaccatccctctccccagctgcaaactgagtgtgccg
gaccctgaggagaggctggactcggggcatgtgtggaagctgcagtgggccaagcagtcc
tggtacctgagcgcctcctccgcagagctgcagcagcagtggctggaaaccctaagcact
gctgcccatggggacacggcccaggacagcccgggggccctgcagcttcaggtccctatg
ggcgcagctgctccgtga

DBGET integrated database retrieval system