KEGG   Homo sapiens (human): 2246Help
Entry
2246              CDS       T01001                                 

Gene name
FGF1, AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-1, FGF-alpha, FGFA, GLIO703, HBGF-1, HBGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2246 (FGF1)
   04015 Rap1 signaling pathway
    2246 (FGF1)
   04010 MAPK signaling pathway
    2246 (FGF1)
   04390 Hippo signaling pathway
    2246 (FGF1)
   04151 PI3K-Akt signaling pathway
    2246 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2246 (FGF1)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    2246 (FGF1)
   05226 Gastric cancer
    2246 (FGF1)
   05218 Melanoma
    2246 (FGF1)
   05224 Breast cancer
    2246 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2246 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2246 (FGF1)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2246 (FGF1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   2246 (FGF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF Fascin
Motif
Other DBs
NCBI-GeneID: 2246
NCBI-ProteinID: NP_000791
OMIM: 131220
HGNC: 3665
Ensembl: ENSG00000113578
Vega: OTTHUMG00000059703
Pharos: P05230(Tchem)
UniProt: P05230
Structure
PDB: 

Position
5q31.3
AA seq 155 aa AA seqDB search
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaggggaaatcaccaccttcacagccctgaccgagaagtttaatctgcctcca
gggaattacaagaagcccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccggatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttc
ctggaaaggctggaggagaaccattacaacacctatatatccaagaagcatgcagagaag
aattggtttgttggcctcaagaagaatgggagctgcaaacgcggtcctcggactcactat
ggccagaaagcaatcttgtttctccccctgccagtctcttctgattaa

DBGET integrated database retrieval system