KEGG   Homo sapiens (human): 2247Help
Entry
2247              CDS       T01001                                 

Gene name
FGF2, BFGF, FGF-2, FGFB, HBGF-2
Definition
(RefSeq) fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04810  Regulation of actin cytoskeleton
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2247 (FGF2)
   04015 Rap1 signaling pathway
    2247 (FGF2)
   04010 MAPK signaling pathway
    2247 (FGF2)
   04151 PI3K-Akt signaling pathway
    2247 (FGF2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    2247 (FGF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2247 (FGF2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    2247 (FGF2)
   05205 Proteoglycans in cancer
    2247 (FGF2)
   05226 Gastric cancer
    2247 (FGF2)
   05218 Melanoma
    2247 (FGF2)
   05224 Breast cancer
    2247 (FGF2)
  09167 Infectious diseases
   05167 Kaposi sarcoma-associated herpesvirus infection
    2247 (FGF2)
  09168 Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    2247 (FGF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2247 (FGF2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2247 (FGF2)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2247 (FGF2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   2247 (FGF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF Fascin IL1
Motif
Other DBs
NCBI-GeneID: 2247
NCBI-ProteinID: NP_001997
OMIM: 134920
HGNC: 3676
Ensembl: ENSG00000138685
Vega: OTTHUMG00000039506
Pharos: P09038(Tchem)
UniProt: P09038 A0A087WUF6
Structure
PDB: 

Position
4q28.1
AA seq 288 aa AA seqDB search
MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ctggtgggtgtggggggtggagatgtagaagatgtgacgccgcggcccggcgggtgccag
attagcggacgcggtgcccgcggttgcaacgggatcccgggcgctgcagcttgggaggcg
gctctccccaggcggcgtccgcggagacacccatccgtgaaccccaggtcccgggccgcc
ggctcgccgcgcaccaggggccggcggacagaagagcggccgagcggctcgaggctgggg
gaccgcgggcgcggccgcgcgctgccgggcgggaggctggggggccggggccggggccgt
gccccggagcgggtcggaggccggggccggggccgggggacggcggctccccgcgcggct
ccagcggctcggggatcccggccgggccccgcagggaccatggcagccgggagcatcacc
acgctgcccgccttgcccgaggatggcggcagcggcgccttcccgcccggccacttcaag
gaccccaagcggctgtactgcaaaaacgggggcttcttcctgcgcatccaccccgacggc
cgagttgacggggtccgggagaagagcgaccctcacatcaagctacaacttcaagcagaa
gagagaggagttgtgtctatcaaaggagtgtgtgctaaccgttacctggctatgaaggaa
gatggaagattactggcttctaaatgtgttacggatgagtgtttcttttttgaacgattg
gaatctaataactacaatacttaccggtcaaggaaatacaccagttggtatgtggcactg
aaacgaactgggcagtataaacttggatccaaaacaggacctgggcagaaagctatactt
tttcttccaatgtctgctaagagctga

DBGET integrated database retrieval system