KEGG   Homo sapiens (human): 2248Help
Entry
2248              CDS       T01001                                 

Gene name
FGF3, HBGF-3, INT2
Definition
(RefSeq) fibroblast growth factor 3
  KO
K04358  fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Disease
H00041  Kaposi sarcoma
H00605  Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2248 (FGF3)
   04015 Rap1 signaling pathway
    2248 (FGF3)
   04010 MAPK signaling pathway
    2248 (FGF3)
   04151 PI3K-Akt signaling pathway
    2248 (FGF3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2248 (FGF3)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    2248 (FGF3)
  09162 Cancers: Specific types
   05226 Gastric cancer
    2248 (FGF3)
   05218 Melanoma
    2248 (FGF3)
   05224 Breast cancer
    2248 (FGF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2248 (FGF3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2248 (FGF3)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2248 (FGF3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   2248 (FGF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF
Motif
Other DBs
NCBI-GeneID: 2248
NCBI-ProteinID: NP_005238
OMIM: 164950
HGNC: 3681
Ensembl: ENSG00000186895
Vega: OTTHUMG00000167888
Pharos: P11487(Tbio)
UniProt: P11487
Position
11q13.3
AA seq 239 aa AA seqDB search
MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP
SGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVER
IHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLP
RVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgggcctaatctggctgctactgctcagcctgctggagcccggctggcccgcagcgggc
cctggggcgcggttgcggcgcgatgcgggcggccgtggcggcgtctacgagcaccttggc
ggggcgccccggcgccgcaagctctactgcgccacgaagtaccacctccagctgcacccg
agcggccgcgtcaacggcagcctggagaacagcgcctacagtattttggagataacggca
gtggaggtgggcattgtggccatcaggggtctcttctccgggcggtacctggccatgaac
aagaggggacgactctatgcttcggagcactacagcgccgagtgcgagtttgtggagcgg
atccacgagctgggctataatacgtatgcctcccggctgtaccggacggtgtctagtacg
cctggggcccgccggcagcccagcgccgagagactgtggtacgtgtctgtgaacggcaag
ggccggccccgcaggggcttcaagacccgccgcacacagaagtcctccctgttcctgccc
cgcgtgctggaccacagggaccacgagatggtgcggcagctacagagtgggctgcccaga
ccccctggtaagggggtccagccccgacggcggcggcagaagcagagcccggataacctg
gagccctctcacgttcaggcttcgagactgggctcccagctggaggccagtgcgcactag

DBGET integrated database retrieval system