KEGG   Homo sapiens (human): 2249Help
Entry
2249              CDS       T01001                                 

Gene name
FGF4, FGF-4, HBGF-4, HST, HST-1, HSTF-1, HSTF1, K-FGF, KFGF
Definition
(RefSeq) fibroblast growth factor 4
  KO
K04358  fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2249 (FGF4)
   04015 Rap1 signaling pathway
    2249 (FGF4)
   04010 MAPK signaling pathway
    2249 (FGF4)
   04151 PI3K-Akt signaling pathway
    2249 (FGF4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2249 (FGF4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2249 (FGF4)
   05226 Gastric cancer
    2249 (FGF4)
   05218 Melanoma
    2249 (FGF4)
   05224 Breast cancer
    2249 (FGF4)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2249 (FGF4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   2249 (FGF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF
Motif
Other DBs
NCBI-GeneID: 2249
NCBI-ProteinID: NP_001998
OMIM: 164980
HGNC: 3682
Ensembl: ENSG00000075388
Vega: OTTHUMG00000167887
Pharos: P08620(Tbio)
UniProt: P08620
Structure
PDB: 

Position
11q13.3
AA seq 206 aa AA seqDB search
MSGPGTAAVALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPV
AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSP
VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIA
LSKNGKTKKGNRVSPTMKVTHFLPRL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggcccgggacggccgcggtagcgctgctcccggcggtcctgctggccttgctg
gcgccctgggcgggccgagggggcgccgccgcacccactgcacccaacggcacgctggag
gccgagctggagcgccgctgggagagcctggtggcgctctcgttggcgcgcctgccggtg
gcagcgcagcccaaggaggcggccgtccagagcggcgccggcgactacctgctgggcatc
aagcggctgcggcggctctactgcaacgtgggcatcggcttccacctccaggcgctcccc
gacggccgcatcggcggcgcgcacgcggacacccgcgacagcctgctggagctctcgccc
gtggagcggggcgtggtgagcatcttcggcgtggccagccggttcttcgtggccatgagc
agcaagggcaagctctatggctcgcccttcttcaccgatgagtgcacgttcaaggagatt
ctccttcccaacaactacaacgcctacgagtcctacaagtaccccggcatgttcatcgcc
ctgagcaagaatgggaagaccaagaaggggaaccgagtgtcgcccaccatgaaggtcacc
cacttcctccccaggctgtga

DBGET integrated database retrieval system