KEGG   Homo sapiens (human): 2253Help
Entry
2253              CDS       T01001                                 

Gene name
FGF8, AIGF, FGF-8, HBGF-8, HH6, KAL6
Definition
(RefSeq) fibroblast growth factor 8
  KO
K04358  fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Disease
H00255  Hypogonadotropic hypogonadism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2253 (FGF8)
   04015 Rap1 signaling pathway
    2253 (FGF8)
   04010 MAPK signaling pathway
    2253 (FGF8)
   04151 PI3K-Akt signaling pathway
    2253 (FGF8)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2253 (FGF8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2253 (FGF8)
   05226 Gastric cancer
    2253 (FGF8)
   05218 Melanoma
    2253 (FGF8)
   05224 Breast cancer
    2253 (FGF8)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2253 (FGF8)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   2253 (FGF8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF Fascin
Motif
Other DBs
NCBI-GeneID: 2253
NCBI-ProteinID: NP_149354
OMIM: 600483
HGNC: 3686
Ensembl: ENSG00000107831
Vega: OTTHUMG00000018940
Pharos: P55075(Tbio)
UniProt: P55075 A1A515
Structure
PDB: 

Position
10q24.32
AA seq 233 aa AA seqDB search
MGSPRSALSCLLLHLLVLCLQAQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLV
TDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGA
ETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKG
SKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcccccgctccgcgctgagctgcctgctgttgcacttgctggtcctctgcctc
caagcccaggaaggcccgggcaggggccctgcgctgggcagggagctcgcttccctgttc
cgggctggccgggagccccagggtgtctcccaacagcatgtgagggagcagagcctggtg
acggatcagctcagccgccgcctcatccggacctaccaactctacagccgcaccagcggg
aagcacgtgcaggtcctggccaacaagcgcatcaacgccatggcagaggacggcgacccc
ttcgcaaagctcatcgtggagacggacacctttggaagcagagttcgagtccgaggagcc
gagacgggcctctacatctgcatgaacaagaaggggaagctgatcgccaagagcaacggc
aaaggcaaggactgcgtcttcacggagattgtgctggagaacaactacacagcgctgcag
aatgccaagtacgagggctggtacatggccttcacccgcaagggccggccccgcaagggc
tccaagacgcggcagcaccagcgtgaggtccacttcatgaagcggctgccccggggccac
cacaccaccgagcagagcctgcgcttcgagttcctcaactacccgcccttcacgcgcagc
ctgcgcggcagccagaggacttgggcccccgagccccgatag

DBGET integrated database retrieval system