KEGG   Homo sapiens (human): 2257Help
Entry
2257              CDS       T01001                                 

Gene name
FGF12, EIEE47, FGF12B, FHF1
Definition
(RefSeq) fibroblast growth factor 12
  KO
K22413  fibroblast growth factor 11/12/13/14
Organism
hsa  Homo sapiens (human)
Disease
H00606  Early infantile epileptic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2257 (FGF12)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2257 (FGF12)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2257 (FGF12)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   2257 (FGF12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF Fascin
Motif
Other DBs
NCBI-GeneID: 2257
NCBI-ProteinID: NP_066360
OMIM: 601513
HGNC: 3668
Ensembl: ENSG00000114279
Vega: OTTHUMG00000156132
Pharos: P61328(Tbio)
UniProt: P61328
Structure
PDB: 

Position
3q28-q29
AA seq 243 aa AA seqDB search
MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKR
PVRRRPEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQG
VKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKE
GQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQ
DST
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggcgatagccagctccttgatccggcagaagcggcaggcgagggagtccaac
agcgaccgagtgtcggcctccaagcgccgctccagccccagcaaagacgggcgctccctg
tgcgagaggcacgtcctcggggtgttcagcaaagtgcgcttctgcagcggccgcaagagg
ccggtgaggcggagaccagaaccccagctcaaagggattgtgacaaggttattcagccag
cagggatacttcctgcagatgcacccagatggtaccattgatgggaccaaggacgaaaac
agcgactacactctcttcaatctaattcccgtgggcctgcgtgtagtggccatccaagga
gtgaaggctagcctctatgtggccatgaatggtgaaggctatctctacagttcagatgtt
ttcactccagaatgcaaattcaaggaatctgtgtttgaaaactactatgtgatctattct
tccacactgtaccgccagcaagaatcaggccgagcttggtttctgggactcaataaagaa
ggtcaaattatgaaggggaacagagtgaagaaaaccaagccctcatcacattttgtaccg
aaacctattgaagtgtgtatgtacagagaaccatcgctacatgaaattggagaaaaacaa
gggcgttcaaggaaaagttctggaacaccaaccatgaatggaggcaaagttgtgaatcaa
gattcaacatag

DBGET integrated database retrieval system