KEGG   Homo sapiens (human): 2259Help
Entry
2259              CDS       T01001                                 

Gene name
FGF14, FGF-14, FHF-4, FHF4, SCA27
Definition
(RefSeq) fibroblast growth factor 14
  KO
K23920  fibroblast growth factor 14
Organism
hsa  Homo sapiens (human)
Pathway
hsa05017  Spinocerebellar ataxia
Disease
H00063  Spinocerebellar ataxia (SCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    2259 (FGF14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2259 (FGF14)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2259 (FGF14)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2259 (FGF14)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   2259 (FGF14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF Fascin
Motif
Other DBs
NCBI-GeneID: 2259
NCBI-ProteinID: NP_004106
OMIM: 601515
HGNC: 3671
Ensembl: ENSG00000102466
Vega: OTTHUMG00000017303
Pharos: Q92915(Tbio)
UniProt: Q92915
Position
13q33.1
AA seq 247 aa AA seqDB search
MAAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRR
LRRQDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVK
TGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQ
AMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKP
VNKSKTT
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggccatcgctagcggcttgatccgccagaagcggcaggcgcgggagcagcac
tgggaccggccgtctgccagcaggaggcggagcagccccagcaagaaccgcgggctctgc
aacggcaacctggtggatatcttctccaaagtgcgcatcttcggcctcaagaagcgcagg
ttgcggcgccaagatccccagctcaagggtatagtgaccaggttatattgcaggcaaggc
tactacttgcaaatgcaccccgatggagctctcgatggaaccaaggatgacagcactaat
tctacactcttcaacctcataccagtgggactacgtgttgttgccatccagggagtgaaa
acagggttgtatatagccatgaatggagaaggttacctctacccatcagaactttttacc
cctgaatgcaagtttaaagaatctgtttttgaaaattattatgtaatctactcatccatg
ttgtacagacaacaggaatctggtagagcctggtttttgggattaaataaggaagggcaa
gctatgaaagggaacagagtaaagaaaaccaaaccagcagctcattttctacccaagcca
ttggaagttgccatgtaccgagaaccatctttgcatgatgttggggaaacggtcccgaag
cctggggtgacgccaagtaaaagcacaagtgcgtctgcaataatgaatggaggcaaacca
gtcaacaagagtaagacaacatag

DBGET integrated database retrieval system