KEGG   Homo sapiens (human): 226Help
Entry
226               CDS       T01001                                 

Gene name
ALDOA, ALDA, GSD12, HEL-S-87p
Definition
(RefSeq) aldolase, fructose-bisphosphate A
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00030  Pentose phosphate pathway
hsa00051  Fructose and mannose metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa04066  HIF-1 signaling pathway
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Disease
H00069  Glycogen storage diseases (GSD)
H01762  Muscle glycogen storage disease
H01952  Glycogen storage disease type XII
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    226 (ALDOA)
   00030 Pentose phosphate pathway
    226 (ALDOA)
   00051 Fructose and mannose metabolism
    226 (ALDOA)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    226 (ALDOA)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     226 (ALDOA)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    226 (ALDOA)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    226 (ALDOA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   226 (ALDOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 226
NCBI-ProteinID: NP_000025
OMIM: 103850
HGNC: 414
Ensembl: ENSG00000149925 ENSG00000285043
Vega: OTTHUMG00000132107
Pharos: P04075(Tbio)
UniProt: P04075 V9HWN7
Structure
PDB: 

Position
16p11.2
AA seq 364 aa AA seqDB search
MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYR
QLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTN
GETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQ
NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHAC
TQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTF
SYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVS
NHAY
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgccctaccaatatccagcactgaccccggagcagaagaaggagctgtctgacatcgct
caccgcatcgtggcacctggcaagggcatcctggctgcagatgagtccactgggagcatt
gccaagcggctgcagtccattggcaccgagaacaccgaggagaaccggcgcttctaccgc
cagctgctgctgacagctgacgaccgcgtgaacccctgcattgggggtgtcatcctcttc
catgagacactctaccagaaggcggatgatgggcgtcccttcccccaagttatcaaatcc
aagggcggtgttgtgggcatcaaggtagacaagggcgtggtccccctggcagggacaaat
ggcgagactaccacccaagggttggatgggctgtctgagcgctgtgcccagtacaagaag
gacggagctgacttcgccaagtggcgttgtgtgctgaagattggggaacacaccccctca
gccctcgccatcatggaaaatgccaatgttctggcccgttatgccagtatctgccagcag
aatggcattgtgcccatcgtggagcctgagatcctccctgatggggaccatgacttgaag
cgctgccagtatgtgaccgagaaggtgctggctgctgtctacaaggctctgagtgaccac
cacatctacctggaaggcaccttgctgaagcccaacatggtcaccccaggccatgcttgc
actcagaagttttctcatgaggagattgccatggcgaccgtcacagcgctgcgccgcaca
gtgccccccgctgtcactgggatcaccttcctgtctggaggccagagtgaggaggaggcg
tccatcaacctcaatgccattaacaagtgccccctgctgaagccctgggccctgaccttc
tcctacggccgagccctgcaggcctctgccctgaaggcctggggcgggaagaaggagaac
ctgaaggctgcgcaggaggagtatgtcaagcgagccctggccaacagccttgcctgtcaa
ggaaagtacactccgagcggtcaggctggggctgctgccagcgagtccctcttcgtctct
aaccacgcctattaa

DBGET integrated database retrieval system