KEGG   Homo sapiens (human): 2260Help
Entry
2260              CDS       T01001                                 

Gene name
FGFR1, BFGFR, CD331, CEK, ECCL, FGFBR, FGFR-1, FLG, FLT-2, FLT2, HBGFR, HH2, HRTFDS, KAL2, N-SAM, OGD, bFGF-R-1
Definition
(RefSeq) fibroblast growth factor receptor 1
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04520  Adherens junction
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04714  Thermogenesis
hsa04810  Regulation of actin cytoskeleton
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05230  Central carbon metabolism in cancer
Network
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00020  Amplified FGFR to RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
N00038  Amplified FGFR to PI3K signaling pathway
Disease
H00031  Breast cancer
H00255  Hypogonadotropic hypogonadism
H00443  Osteoglophonic dysplasia
H00458  Syndromic craniosynostoses
H01207  Trigonocephaly
H01756  Pfeiffer syndrome
H01850  Hartsfield syndrome
H01988  Jackson-Weiss syndrome
Drug target
Brivanib (DG01373): D08878 D09589
Erdafitinib: D10927
Lenvatinib (DG01362): D09919 D09920
Nintedanib (DG01374): D10396 D10481
Regorafenib (DG00720): D10137 D10138
Repifermin: D05716
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2260 (FGFR1)
   04015 Rap1 signaling pathway
    2260 (FGFR1)
   04010 MAPK signaling pathway
    2260 (FGFR1)
   04151 PI3K-Akt signaling pathway
    2260 (FGFR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    2260 (FGFR1)
   04550 Signaling pathways regulating pluripotency of stem cells
    2260 (FGFR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2260 (FGFR1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    2260 (FGFR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    2260 (FGFR1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    2260 (FGFR1)
   05230 Central carbon metabolism in cancer
    2260 (FGFR1)
   05205 Proteoglycans in cancer
    2260 (FGFR1)
  09162 Cancers: Specific types
   05218 Melanoma
    2260 (FGFR1)
   05215 Prostate cancer
    2260 (FGFR1)
   05224 Breast cancer
    2260 (FGFR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2260 (FGFR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2260 (FGFR1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2260 (FGFR1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2260 (FGFR1)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   2260 (FGFR1)
CD molecules [BR:hsa04090]
 Proteins
  2260 (FGFR1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   2260 (FGFR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 ig Ig_2 V-set FGFR3_TM Ig_5 C2-set_2 Ig_4 Ig_6 Pkinase_fungal Kinase-like DUF1615 DUF4611
Motif
Other DBs
NCBI-GeneID: 2260
NCBI-ProteinID: NP_075598
OMIM: 136350
HGNC: 3688
Ensembl: ENSG00000077782
Vega: OTTHUMG00000147366
Pharos: P11362(Tclin)
UniProt: P11362
Structure
PDB: 

Position
8p11.23
AA seq 822 aa AA seqDB search
MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSF
PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgtggagctggaagtgcctcctcttctgggctgtgctggtcacagccacactctgcacc
gctaggccgtccccgaccttgcctgaacaagcccagccctggggagcccctgtggaagtg
gagtccttcctggtccaccccggtgacctgctgcagcttcgctgtcggctgcgggacgat
gtgcagagcatcaactggctgcgggacggggtgcagctggcggaaagcaaccgcacccgc
atcacaggggaggaggtggaggtgcaggactccgtgcccgcagactccggcctctatgct
tgcgtaaccagcagcccctcgggcagtgacaccacctacttctccgtcaatgtttcagat
gctctcccctcctcggaggatgatgatgatgatgatgactcctcttcagaggagaaagaa
acagataacaccaaaccaaaccgtatgcccgtagctccatattggacatccccagaaaag
atggaaaagaaattgcatgcagtgccggctgccaagacagtgaagttcaaatgcccttcc
agtgggaccccaaaccccacactgcgctggttgaaaaatggcaaagaattcaaacctgac
cacagaattggaggctacaaggtccgttatgccacctggagcatcataatggactctgtg
gtgccctctgacaagggcaactacacctgcattgtggagaatgagtacggcagcatcaac
cacacataccagctggatgtcgtggagcggtcccctcaccggcccatcctgcaagcaggg
ttgcccgccaacaaaacagtggccctgggtagcaacgtggagttcatgtgtaaggtgtac
agtgacccgcagccgcacatccagtggctaaagcacatcgaggtgaatgggagcaagatt
ggcccagacaacctgccttatgtccagatcttgaagactgctggagttaataccaccgac
aaagagatggaggtgcttcacttaagaaatgtctcctttgaggacgcaggggagtatacg
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaa
gccctggaagagaggccggcagtgatgacctcgcccctgtacctggagatcatcatctat
tgcacaggggccttcctcatctcctgcatggtggggtcggtcatcgtctacaagatgaag
agtggtaccaagaagagtgacttccacagccagatggctgtgcacaagctggccaagagc
atccctctgcgcagacaggtaacagtgtctgctgactccagtgcatccatgaactctggg
gttcttctggttcggccatcacggctctcctccagtgggactcccatgctagcaggggtc
tctgagtatgagcttcccgaagaccctcgctgggagctgcctcgggacagactggtctta
ggcaaacccctgggagagggctgctttgggcaggtggtgttggcagaggctatcgggctg
gacaaggacaaacccaaccgtgtgaccaaagtggctgtgaagatgttgaagtcggacgca
acagagaaagacttgtcagacctgatctcagaaatggagatgatgaagatgatcgggaag
cataagaatatcatcaacctgctgggggcctgcacgcaggatggtcccttgtatgtcatc
gtggagtatgcctccaagggcaacctgcgggagtacctgcaggcccggaggcccccaggg
ctggaatactgctacaaccccagccacaacccagaggagcagctctcctccaaggacctg
gtgtcctgcgcctaccaggtggcccgaggcatggagtatctggcctccaagaagtgcata
caccgagacctggcagccaggaatgtcctggtgacagaggacaatgtgatgaagatagca
gactttggcctcgcacgggacattcaccacatcgactactataaaaagacaaccaacggc
cgactgcctgtgaagtggatggcacccgaggcattatttgaccggatctacacccaccag
agtgatgtgtggtctttcggggtgctcctgtgggagatcttcactctgggcggctcccca
taccccggtgtgcctgtggaggaacttttcaagctgctgaaggagggtcaccgcatggac
aagcccagtaactgcaccaacgagctgtacatgatgatgcgggactgctggcatgcagtg
ccctcacagagacccaccttcaagcagctggtggaagacctggaccgcatcgtggccttg
acctccaaccaggagtacctggacctgtccatgcccctggaccagtactcccccagcttt
cccgacacccggagctctacgtgctcctcaggggaggattccgtcttctctcatgagccg
ctgcccgaggagccctgcctgccccgacacccagcccagcttgccaatggcggactcaaa
cgccgctga

DBGET integrated database retrieval system