KEGG   Homo sapiens (human): 2262Help
Entry
2262              CDS       T01001                                 

Gene name
GPC5
Definition
(RefSeq) glypican 5
  KO
K08111  glypican 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    2262 (GPC5)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    2262 (GPC5)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   2262 (GPC5)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  2262 (GPC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glypican Fz
Motif
Other DBs
NCBI-GeneID: 2262
NCBI-ProteinID: NP_004457
OMIM: 602446
HGNC: 4453
Ensembl: ENSG00000179399
Vega: OTTHUMG00000017200
Pharos: P78333(Tbio)
UniProt: P78333
Position
13q31.3
AA seq 572 aa AA seqDB search
MDAQTWPVGFRCLLLLALVGSARSEGVQTCEEVRKLFQWRLLGAVRGLPDSPRAGPDLQV
CISKKPTCCTRKMEERYQIAARQDMQQFLQTSSSTLKFLISRNAAAFQETLETLIKQAEN
YTSILFCSTYRNMALEAAASVQEFFTDVGLYLFGADVNPEEFVNRFFDSLFPLVYNHLIN
PGVTDSSLEYSECIRMARRDVSPFGNIPQRVMGQMGRSLLPSRTFLQALNLGIEVINTTD
YLHFSKECSRALLKMQYCPHCQGLALTKPCMGYCLNVMRGCLAHMAELNPHWHAYIRSLE
ELSDAMHGTYDIGHVLLNFHLLVNDAVLQAHLNGQKLLEQVNRICGRPVRTPTQSPRCSF
DQSKEKHGMKTTTRNSEETLANRRKEFINSLRLYRSFYGGLADQLCANELAAADGLPCWN
GEDIVKSYTQRVVGNGIKAQSGNPEVKVKGIDPVINQIIDKLKHVVQLLQGRSPKPDKWE
LLQLGSGGGMVEQVSGDCDDEDGCGGSGSGEVKRTLKITDWMPDDMNFSDVKQIHQTDTG
STLDTTGAGCAVATESMTFTLISVVMLLPGIW
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggacgcacagacctggcccgtgggctttcgctgcctcctccttctggccctggttggg
tccgcccgcagcgagggcgtgcagacctgcgaagaagttcggaaacttttccagtggcgg
ctgctgggagctgtcagggggctgccggattcgccgcgggcaggacctgatcttcaggtt
tgcatatccaaaaagcctacatgttgcaccaggaagatggaggagagatatcagattgcg
gctcgccaggatatgcagcagtttcttcaaacgtccagctctacattaaagtttctaata
tctcgaaatgcggctgcttttcaagaaacccttgaaactctcatcaaacaagcagaaaat
tacaccagtatacttttttgcagtacctacaggaacatggccttggaggctgctgcttcg
gttcaggagttcttcactgatgtggggctgtatttatttggtgcggatgttaatcctgaa
gaatttgtaaacagattttttgacagtctttttcctctggtctacaaccacctcattaac
cctggtgtgactgacagttccctggaatactcagaatgcatccggatggctcgccgggat
gtgagtccatttggtaatattccccaaagagtaatgggacagatggggaggtccctgctg
cccagccgcacttttctgcaggcactcaatctgggcattgaagtcatcaacaccacagac
tatctgcacttctccaaagagtgcagcagagccctcctgaagatgcaatactgcccgcac
tgccaaggcctggcgctcactaagccttgtatgggatactgcctcaatgtcatgcgaggc
tgcctggcgcacatggcggagcttaatccacactggcatgcatatatccggtcgttggaa
gaactctcggatgcaatgcatggaacatacgacattggacacgtgctgctgaactttcac
ttgcttgttaatgatgctgtgttacaggctcacctcaatggacaaaaattattggaacag
gtaaataggatttgtggccgccctgtaagaacacccacacaaagcccccgttgttctttt
gatcagagcaaagagaagcatggaatgaagaccaccacaaggaacagtgaagagacgctt
gccaacagaagaaaagaatttatcaacagccttcgactgtacaggtcattctatggaggt
ctagctgatcagctttgtgctaatgaattagctgctgcagatggacttccctgctggaat
ggagaagatatagtaaaaagttatactcagcgtgtggttggaaatggaatcaaagcccag
tctggaaatcctgaagtcaaagtcaaaggaattgatcctgtgataaatcagattattgat
aaactgaagcatgttgttcagttgttacagggtagatcacccaaacctgacaagtgggaa
cttcttcagctgggcagtggtggaggcatggttgaacaagtcagtggggactgtgatgat
gaagatggttgcgggggatcaggaagtggagaagtcaagaggacactgaagatcacagac
tggatgccagatgatatgaacttcagtgatgtaaagcaaatccatcaaacagacactggc
agtactttagacacaacaggagcaggatgtgcagtggcgactgaatctatgacattcact
ctgataagtgtggtgatgttacttcccgggatttggtaa

DBGET integrated database retrieval system