KEGG   Homo sapiens (human): 2264Help
Entry
2264              CDS       T01001                                 

Gene name
FGFR4, CD334, JTK2, TKF
Definition
(RefSeq) fibroblast growth factor receptor 4
  KO
K05095  fibroblast growth factor receptor 4 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04144  Endocytosis
hsa04151  PI3K-Akt signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06261  Gastric cancer
nt06265  Bladder cancer
nt06270  Breast cancer
  Element
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Drug target
Erdafitinib: D10927
Lenvatinib (DG01362): D09919 D09920
Repifermin: D05716
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2264 (FGFR4)
   04015 Rap1 signaling pathway
    2264 (FGFR4)
   04010 MAPK signaling pathway
    2264 (FGFR4)
   04151 PI3K-Akt signaling pathway
    2264 (FGFR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    2264 (FGFR4)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    2264 (FGFR4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2264 (FGFR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2264 (FGFR4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2264 (FGFR4)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2264 (FGFR4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2264 (FGFR4)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   2264 (FGFR4)
CD molecules [BR:hsa04090]
 Proteins
  2264 (FGFR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_3 I-set Ig_2 ig V-set Ig_5 C2-set_2 Kinase-like
Motif
Other DBs
NCBI-GeneID: 2264
NCBI-ProteinID: NP_002002
OMIM: 134935
HGNC: 3691
Ensembl: ENSG00000160867
Vega: OTTHUMG00000151523
Pharos: P22455(Tclin)
UniProt: P22455
Structure
PDB: 

Position
5q35.2
AA seq 802 aa AA seqDB search
MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRA
ERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDS
LTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTP
TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLD
VLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP
YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTA
AAPEARYTDIILYASGSLALAVLLLLAGLYRGQALHGRHPRPPATVQKLSRFPLARQFSL
ESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQ
VVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVC
TQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM
QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEA
LFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYG
LMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDS
VFSHDPLPLGSSSFPFGSGVQT
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgctgctggccctgttgggggtcctgctgagtgtgcctgggcctccagtcttg
tccctggaggcctctgaggaagtggagcttgagccctgcctggctcccagcctggagcag
caagagcaggagctgacagtagcccttgggcagcctgtgcgtctgtgctgtgggcgggct
gagcgtggtggccactggtacaaggagggcagtcgcctggcacctgctggccgtgtacgg
ggctggaggggccgcctagagattgccagcttcctacctgaggatgctggccgctacctc
tgcctggcacgaggctccatgatcgtcctgcagaatctcaccttgattacaggtgactcc
ttgacctccagcaacgatgatgaggaccccaagtcccatagggacccctcgaataggcac
agttacccccagcaagcaccctactggacacacccccagcgcatggagaagaaactgcat
gcagtacctgcggggaacaccgtcaagttccgctgtccagctgcaggcaaccccacgccc
accatccgctggcttaaggatggacaggcctttcatggggagaaccgcattggaggcatt
cggctgcgccatcagcactggagtctcgtgatggagagcgtggtgccctcggaccgcggc
acatacacctgcctggtagagaacgctgtgggcagcatccgctataactacctgctagat
gtgctggagcggtccccgcaccggcccatcctgcaggccgggctcccggccaacaccaca
gccgtggtgggcagcgacgtggagctgctgtgcaaggtgtacagcgatgcccagccccac
atccagtggctgaagcacatcgtcatcaacggcagcagcttcggagccgacggtttcccc
tatgtgcaagtcctaaagactgcagacatcaatagctcagaggtggaggtcctgtacctg
cggaacgtgtcagccgaggacgcaggcgagtacacctgcctcgcaggcaattccatcggc
ctctcctaccagtctgcctggctcacggtgctgccagaggaggaccccacatggaccgca
gcagcgcccgaggccaggtatacggacatcatcctgtacgcgtcgggctccctggccttg
gctgtgctcctgctgctggccgggctgtatcgagggcaggcgctccacggccggcacccc
cgcccgcccgccactgtgcagaagctctcccgcttccctctggcccgacagttctccctg
gagtcaggctcttccggcaagtcaagctcatccctggtacgaggcgtgcgtctctcctcc
agcggccccgccttgctcgccggcctcgtgagtctagatctacctctcgacccactatgg
gagttcccccgggacaggctggtgcttgggaagcccctaggcgagggctgctttggccag
gtagtacgtgcagaggcctttggcatggaccctgcccggcctgaccaagccagcactgtg
gccgtcaagatgctcaaagacaacgcctctgacaaggacctggccgacctggtctcggag
atggaggtgatgaagctgatcggccgacacaagaacatcatcaacctgcttggtgtctgc
acccaggaagggcccctgtacgtgatcgtggagtgcgccgccaagggaaacctgcgggag
ttcctgcgggcccggcgccccccaggccccgacctcagccccgacggtcctcggagcagt
gaggggccgctctccttcccagtcctggtctcctgcgcctaccaggtggcccgaggcatg
cagtatctggagtcccggaagtgtatccaccgggacctggctgcccgcaatgtgctggtg
actgaggacaatgtgatgaagattgctgactttgggctggcccgcggcgtccaccacatt
gactactataagaaaaccagcaacggccgcctgcctgtgaagtggatggcgcccgaggcc
ttgtttgaccgggtgtacacacaccagagtgacgtgtggtcttttgggatcctgctatgg
gagatcttcaccctcgggggctccccgtatcctggcatcccggtggaggagctgttctcg
ctgctgcgggagggacatcggatggaccgacccccacactgccccccagagctgtacggg
ctgatgcgtgagtgctggcacgcagcgccctcccagaggcctaccttcaagcagctggtg
gaggcgctggacaaggtcctgctggccgtctctgaggagtacctcgacctccgcctgacc
ttcggaccctattccccctctggtggggacgccagcagcacctgctcctccagcgattct
gtcttcagccacgaccccctgccattgggatccagctccttccccttcgggtctggggtg
cagacatga

DBGET integrated database retrieval system