KEGG   Homo sapiens (human): 2267
Entry
2267              CDS       T01001                                 
Symbol
FGL1, HFREP1, HP-041, HPS, LFIRE-1, LFIRE1
Name
(RefSeq) fibrinogen like 1
  KO
K25536  fibrinogen-like protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    2267 (FGL1)
SSDB
Motif
Pfam: Fibrinogen_C
Other DBs
NCBI-GeneID: 2267
NCBI-ProteinID: NP_004458
OMIM: 605776
HGNC: 3695
Ensembl: ENSG00000104760
Pharos: Q08830(Tbio)
UniProt: Q08830
Position
8:complement(17864389..17895538)
AA seq 312 aa
MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEV
QFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGW
TVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFE
KNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRD
HDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVM
KIRPNDFIPNVI
NT seq 939 nt   +upstreamnt  +downstreamnt
atggcaaaggtgttcagtttcatccttgttaccaccgctctgacaatgggcagggaaatt
tcggcgctcgaggactgtgcccaggagcagatgcggctcagagcccaggtgcgcctgctt
gagacccgggtcaaacagcaacaggtcaagatcaagcagcttttgcaggagaatgaagtc
cagttccttgataaaggagatgagaatactgtcattgatcttggaagcaagaggcagtat
gcagattgttcagagattttcaatgatgggtataagctcagtggattttacaaaatcaaa
cctctccagagcccagcagaattttctgtttattgtgacatgtccgatggaggaggatgg
actgtaattcagagacgatctgatggcagtgaaaactttaacagaggatggaaagactat
gaaaatggctttggaaattttgtccaaaaacatggtgaatattggctgggcaataaaaat
cttcacttcttgaccactcaagaagactacactttaaaaatcgaccttgcagattttgaa
aaaaatagccgttatgcacaatataagaatttcaaagttggagatgaaaagaatttctac
gagttgaatattggggaatattctggaacagctggagattcccttgcggggaattttcat
cctgaggtgcagtggtgggctagtcaccaaagaatgaaattcagcacgtgggacagagat
catgacaactatgaagggaactgcgcagaagaagatcagtctggctggtggtttaacagg
tgtcactctgcaaacctgaatggtgtatactacagcggcccctacacggctaaaacagac
aatgggattgtctggtacacctggcatgggtggtggtattctctgaaatctgtggttatg
aaaattaggccaaatgattttattccaaatgtaatttaa

DBGET integrated database retrieval system