KEGG   Homo sapiens (human): 2272Help
Entry
2272              CDS       T01001                                 

Gene name
FHIT, AP3Aase, FRA3B
Definition
(RefSeq) fragile histidine triad
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
Disease
H00013  Small cell lung cancer
H00014  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    2272 (FHIT)
 09160 Human Diseases
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    2272 (FHIT)
   05223 Non-small cell lung cancer
    2272 (FHIT)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     2272 (FHIT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HIT DcpS_C
Motif
Other DBs
NCBI-GeneID: 2272
NCBI-ProteinID: NP_001159715
OMIM: 601153
HGNC: 3701
Ensembl: ENSG00000189283
Vega: OTTHUMG00000158591
Pharos: P49789(Tchem)
UniProt: P49789 A0A024R366
Structure
PDB: 

Position
3p14.2
AA seq 147 aa AA seqDB search
MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ
TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH
DKEDFPASWRSEEEMAAEAAALRVYFQ
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcagatttggccaacatctcatcaagccctctgtagtgtttctcaaaacagaa
ctgtccttcgctcttgtgaataggaaacctgtggtaccaggacatgtccttgtgtgcccg
ctgcggccagtggagcgcttccatgacctgcgtcctgatgaagtggccgatttgtttcag
acgacccagagagtcgggacagtggtggaaaaacatttccatgggacctctctcaccttt
tccatgcaggatggccccgaagccggacagactgtgaagcacgttcacgtccatgttctt
cccaggaaggctggagactttcacaggaatgacagcatctatgaggagctccagaaacat
gacaaggaggactttcctgcctcttggagatcagaggaggaaatggcagcagaagccgca
gctctgcgggtctactttcagtga

DBGET integrated database retrieval system