KEGG   Homo sapiens (human): 22794Help
Entry
22794             CDS       T01001                                 

Gene name
CASC3, BTZ, MLN51
Definition
(RefSeq) CASC3, exon junction complex subunit
  KO
K14323  protein CASC3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
Module
hsa_M00430  Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    22794 (CASC3)
   03015 mRNA surveillance pathway
    22794 (CASC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    22794 (CASC3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     22794 (CASC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Btz
Motif
Other DBs
NCBI-GeneID: 22794
NCBI-ProteinID: NP_031385
OMIM: 606504
HGNC: 17040
Ensembl: ENSG00000108349
Vega: OTTHUMG00000133323
Pharos: O15234(Tbio)
UniProt: O15234
Structure
PDB: 

Position
17q21.1
AA seq 703 aa AA seqDB search
MADRRRQRASQDTEDEESGASGSDSGGSPLRGGGSCSGSAGGGGSGSLPSQRGGRTGALH
LRRVESGGAKSAEESECESEDGIEGDAVLSDYESAEDSEGEEGEYSEEENSKVELKSEAN
DAVNSSTKEEKGEEKPDTKSTVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPA
YIPRKGLFFEHDLRGQTQEEEVRPKGRQRKLWKDEGRWEHDKFREDEQAPKSRQELIALY
GYDIRSAHNPDDIKPRRIRKPRYGSPPQRDPNWNGERLNKSHRHQGLGGTLPPRTFINRN
AAGTGRMSAPRNYSRSGGFKEGRAGFRPVEAGGQHGGRSGETVKHEISYRSRRLEQTSVR
DPSPEADAPVLGSPEKEEAASEPPAAAPDAAPPPPDRPIEKKSYSRARRTRTKVGDAVKL
AEEVPPPPEGLIPAPPVPETTPTPPTKTGTWEAPVDSSTSGLEQDVAQLNIAEQNWSPGQ
PSFLQPRELRGMPNHIHMGAGPPPQFNRMEEMGVQGGRAKRYSSQRQRPVPEPPAPPVHI
SIMEGHYYDPLQFQGPIYTHGDSPAPLPPQGMLVQPGMNLPHPGLHPHQTPAPLPNPGLY
PPPVSMSPGQPPPQQLLAPTYFSAPGVMNFGNPSYPYAPGALPPPPPPHLYPNTQAPSQV
YGGVTYYNPAQQQVQPKPSPPRRTPQPVTIKPPPPEVVSRGSS
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccggcggcggcagcgcgcttcgcaagacaccgaggacgaggaatctggtgct
tcgggctccgacagcggcggctccccgttgcggggaggcgggagctgcagcggtagcgcc
ggaggcggcggcagcggctctctgccttcacagcgcggaggccgaaccggggcccttcat
ctgcggcgggtggagagcgggggcgccaagagtgctgaggagtcggagtgtgagagtgaa
gatggcattgaaggtgatgctgttctctcggattatgaaagtgcagaagactcggaaggt
gaagaaggtgaatacagtgaagaggaaaactccaaagtggagctgaaatcagaagctaat
gatgctgttaattcttcaacaaaagaagagaagggagaagaaaagcctgacaccaaaagc
actgtgactggagagaggcaaagtggggacggacaggagagcacagagcctgtggagaac
aaagtgggtaaaaagggccctaagcatttggatgatgatgaagatcggaagaatccagca
tacatacctcggaaagggctcttctttgagcatgatcttcgagggcaaactcaggaggag
gaagtcagacccaaggggcgtcagcgaaagctatggaaggatgagggtcgctgggagcat
gacaagttccgggaagatgagcaggccccaaagtcccgacaggagctcattgctctttat
ggttatgacattcgctcagctcataatcctgatgacatcaaacctcgaagaatccggaaa
ccccgatatgggagtcctccacaaagagatccaaactggaacggtgagcggctaaacaag
tctcatcgccaccagggtcttgggggcaccctaccaccaaggacatttattaacaggaat
gctgcaggtaccggccgtatgtctgcacccaggaattattctcgatctgggggcttcaag
gaaggtcgtgctggttttaggcctgtggaagctggtgggcagcatggtggccggtctggt
gagactgttaagcatgagattagttaccggtcacggcgcctagagcagacttctgtgagg
gatccatctccagaagcagatgctccagtgcttggcagtcctgagaaggaagaggcagcc
tcagagccaccagctgctgctcctgatgctgcaccaccaccccctgataggcccattgag
aagaaatcctattcccgggcaagaagaactcgaaccaaagttggagatgcagtcaagctt
gcagaggaggtgccccctcctcctgaaggactgattccagcacctccagtcccagaaacc
accccaactccacctactaagactgggacctgggaagctccggtggattctagtacaagt
ggacttgagcaagatgtggcacaactaaatatagcagaacagaattggagtccggggcag
ccttctttcctgcaaccacgggaacttcgaggtatgcccaaccatatacacatgggagca
ggacctccacctcagtttaaccggatggaagaaatgggtgtccagggtggtcgagccaaa
cgctattcatcccagcggcaaagacctgtgccagagccccccgcccctccagtgcatatc
agtatcatggagggacattactatgatccactgcagttccagggaccaatctatacccat
ggtgacagccctgccccgctgcctccacagggcatgcttgtgcagccaggaatgaacctt
ccccacccaggtttacatccccaccagacaccagctcctctgcccaatccaggcctctat
cccccaccagtgtccatgtctccaggacagccaccacctcagcagttgcttgctcctact
tacttttctgctccaggcgtcatgaactttggtaatcccagttacccttatgctccaggg
gcactgcctcccccaccaccgcctcatctgtatcctaatacacaggccccatcacaggta
tatggaggagtgacctactataaccccgcccagcagcaggtgcagccaaagccctcccca
ccccggaggactccccagccagtcaccatcaagccccctccacctgaggttgtaagcagg
ggttccagttaa

DBGET integrated database retrieval system