KEGG   Homo sapiens (human): 22795
Entry
22795             CDS       T01001                                 
Symbol
NID2, NID-2
Name
(RefSeq) nidogen 2
  KO
K06826  nidogen (entactin)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04820  Cytoskeleton in muscle cells
Network
nt06539  Cytoskeleton in muscle cells
  Element
N01814  Extracellular matrix - Basal lamina
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    22795 (NID2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    22795 (NID2)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EGF-like domain-containing proteins
  cEGF domain-containing proteins
   22795 (NID2)
SSDB
Motif
Pfam: G2F NIDO Thyroglobulin_1 EGF_3 Ldl_recept_b cEGF EGF_CA EGF FXa_inhibition hEGF SGL Plasmod_Pvs28 EGF_MSP1_1
Other DBs
NCBI-GeneID: 22795
NCBI-ProteinID: NP_031387
OMIM: 605399
HGNC: 13389
Ensembl: ENSG00000087303
UniProt: Q14112
Position
14:complement(52004809..52069059)
AA seq 1375 aa
MEGDRVAGRPVLSSLPVLLLLPLLMLRAAALHPDELFPHGESWGDQLLQEGDDESSAVVK
LANPLHFYEARFSNLYVGTNGIISTQDFPRETQYVDYDFPTDFPAIAPFLADIDTSHGRG
RVLYREDTSPAVLGLAARYVRAGFPRSARFTPTHAFLATWEQVGAYEEVKRGALPSGELN
TFQAVLASDGSDSYALFLYPANGLQFLGTRPKESYNVQLQLPARVGFCRGEADDLKSEGP
YFSLTSTEQSVKNLYQLSNLGIPGVWAFHIGSTSPLDNVRPAAVGDLSAAHSSVPLGRSF
SHATALESDYNEDNLDYYDVNEEEAEYLPGEPEEALNGHSSIDVSFQSKVDTKPLEESST
LDPHTKEGTSLGEVGGPDLKGQVEPWDERETRSPAPPEVDRDSLAPSWETPPPYPENGSI
QPYPDGGPVPSEMDVPPAHPEEEIVLRSYPASGHTTPLSRGTYEVGLEDNIGSNTEVFTY
NAANKETCEHNHRQCSRHAFCTDYATGFCCHCQSKFYGNGKHCLPEGAPHRVNGKVSGHL
HVGHTPVHFTDVDLHAYIVGNDGRAYTAISHIPQPAAQALLPLTPIGGLFGWLFALEKPG
SENGFSLAGAAFTHDMEVTFYPGEETVRITQTAEGLDPENYLSIKTNIQGQVPYVSANFT
AHISPYKELYHYSDSTVTSTSSRDYSLTFGAINQTWSYRIHQNITYQVCRHAPRHPSFPT
TQQLNVDRVFALYNDEERVLRFAVTNQIGPVKEDSDPTPGNPCYDGSHMCDTTARCHPGT
GVDYTCECASGYQGDGRNCVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADDRH
TCILITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACLPGYAGDGHQCTDVDECSENR
CHPAATCYNTPGSFSCRCQPGYYGDGFQCIPDSTSSLTPCEQQQRHAQAQYAYPGARFHI
PQCDEQGNFLPLQCHGSTGFCWCVDPDGHEVPGTQTPPGSTPPHCGPSPEPTQRPPTICE
RWRENLLEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGT
TPACIPTVAPPMVRPTPRPDVTPPSVGTFLLYTQGQQIGYLPLNGTRLQKDAAKTLLSLH
GSIIVGIDYDCRERMVYWTDVAGRTISRAGLELGAEPETIVNSGLISPEGLAIDHIRRTM
YWTDSVLDKIESALLDGSERKVLFYTDLVNPRAIAVDPIRGNLYWTDWNREAPKIETSSL
DGENRRILINTDIGLPNGLTFDPFSKLLCWADAGTKKLECTLPDGTGRRVIQNNLKYPFS
IVSYADHFYHTDWRRDGVVSVNKHSGQFTDEYLPEQRSHLYGITAVYPYCPTGRK
NT seq 4128 nt   +upstreamnt  +downstreamnt
atggagggggaccgggtggccgggcggccggtgctgtcgtcgttaccagtgctactgctg
ctgccgttgctaatgttgcgggccgcggcgctgcacccagacgagctcttcccacacggg
gagtcgtggggggaccagctcctgcaggaaggcgacgacgaaagctcagccgtggtgaag
ctggcgaatcccctgcacttctacgaagcccgattcagcaacctctacgtgggcaccaac
ggcatcatctccactcaggacttccccagggaaacgcagtatgtggactatgatttcccc
accgacttcccggccatcgccccttttctggcggacatcgacacgagccacggcagaggc
cgagtcctgtaccgagaggacacctcccccgcagtgctgggcctggccgcccgctatgtg
cgcgctggcttcccgcgctctgcgcgctttacccccacccacgccttcctggccacctgg
gagcaggtaggcgcttacgaggaggtcaagcgcggggcgctgccctcgggagagctgaac
actttccaggcagttttggcatctgatgggtctgatagctacgccctctttctttatcct
gccaacggcctgcagttccttggaacccgccccaaagagtcttacaatgtccagcttcag
cttccagctcgggtgggcttctgccgaggggaggctgatgatctgaagtcagaaggacca
tatttcagcttgactagcactgaacagtctgtgaaaaatctctatcaactaagcaacctg
gggatccctggagtgtgggctttccatatcggcagcacttccccgttggacaatgtcagg
ccagctgcagttggagacctttccgctgcccactcttctgttcccctgggacgttccttc
agccatgctacagccctggaaagtgactataatgaggacaatttggattactatgatgtg
aatgaggaggaagctgaataccttccgggtgaaccagaggaggcattgaatggccacagc
agcattgatgtttccttccaatccaaagtggatacaaagcctttagaggaatcttccacc
ttggatcctcacaccaaagaaggaacatctctgggagaggtagggggcccagatttaaaa
ggccaagttgagccctgggatgagagagagaccagaagcccagctccaccagaggtagac
agagattcactggctccttcctgggaaaccccaccaccgtaccccgaaaacggaagcatc
cagccctacccagatggagggccagtgccttcggaaatggatgttcccccagctcatcct
gaagaagaaattgttcttcgaagttaccctgcttcaggtcacactacacccttaagtcga
gggacgtatgaggtgggactggaagacaacataggttccaacaccgaggtcttcacgtat
aatgctgccaacaaggaaacctgtgaacacaaccacagacaatgctcccggcatgccttc
tgcacggactatgccactggcttctgctgccactgccaatccaagttttatggaaatggg
aagcactgtctgcctgaaggggcacctcaccgagtgaatgggaaagtgagtggccacctc
cacgtgggccatacacccgtgcacttcactgatgtggacctgcatgcgtatatcgtgggc
aatgatggcagagcctacacggccatcagccacatcccacagccagcagcccaggccctc
ctccccctcacaccaattggaggcctgtttggctggctctttgctttagaaaaacctggc
tctgagaacggcttcagcctcgcaggtgctgcctttacccatgacatggaagttacattc
tacccgggagaggagacggttcgtatcactcaaactgctgagggacttgacccagagaac
tacctgagcattaagaccaacattcaaggccaggtgccttacgtctcagcaaatttcaca
gcccacatctctccctacaaggagctgtaccactactccgactccactgtgacctctaca
agttccagagactactctctgacttttggtgcaatcaaccaaacatggtcctaccgcatc
caccagaacatcacttaccaggtgtgcaggcacgcccccagacacccgtccttccccacc
acccagcagctgaacgtggaccgggtctttgccttgtataatgacgaagaaagagtgctt
agatttgctgtgaccaatcaaattggcccggtcaaagaggattcagaccccactccgggg
aatccttgctatgatgggagccacatgtgtgacacaacagcacggtgccatccagggaca
ggtgtagattacacctgtgagtgcgcatctgggtaccagggagatggacggaactgtgtg
gatgaaaatgaatgtgcaactggctttcatcgctgtggccccaactctgtatgtatcaac
ttgcctggaagctacaggtgtgagtgccggagtggttatgagtttgcagatgaccggcat
acttgcatcttgatcaccccacctgccaacccctgtgaggatggcagtcatacctgtgct
cctgctgggcaggcccggtgtgttcaccatggaggcagcacgttcagctgtgcctgcctg
cctggttatgccggcgatgggcaccagtgcactgatgtagatgaatgctcagaaaacaga
tgtcaccctgcagctacctgctacaatactcctggttccttctcctgccgttgtcaaccc
ggatattatggggatggatttcagtgcatacctgactccacctcaagcctgacaccctgt
gaacaacagcagcgccatgcccaggcccagtatgcctaccctggggcccggttccacatc
ccccaatgcgacgagcagggcaacttcctgcccctacagtgtcatggcagcactggtttc
tgctggtgcgtggaccctgatggtcatgaagttcctggtacccagactccacctggctcc
accccgcctcactgtggaccatcaccagagcccacccagaggcccccgaccatctgtgag
cgctggagggaaaacctgctggagcactacggtggcaccccccgggatgaccagtacgtg
ccccagtgcgatgacctgggccacttcatccccctgcagtgccacggaaagagcgacttc
tgctggtgtgtggacaaagatggcagagaggtgcagggcacccgctcccagccaggcacc
acccctgcgtgtatacccaccgtcgctccacccatggtccggcccacgccccggccagat
gtgacccctccatctgtgggcaccttcctgctctatactcagggccagcagattggctac
ttacccctcaatggcaccaggcttcagaaggatgcagctaagaccctgctgtctctgcat
ggctccataatcgtgggaattgattacgactgccgggagaggatggtgtactggacagat
gttgctggacggacaatcagccgtgctggtctggaactgggagcagagcctgagacgatc
gtgaattcaggtctgataagccctgaaggacttgccatagaccacatccgcagaacaatg
tactggacggacagtgtcctggataagatagagagcgccctgctggatggctctgagcgc
aaggtcctcttctacacagatctggtgaatccccgtgccatcgctgtggatccaatccga
ggcaacttgtactggacagactggaatagagaagctcctaaaattgaaacgtcatcttta
gatggagaaaacagaagaattctgatcaatacagacattggattgcccaatggcttaacc
tttgaccctttctctaaactgctctgctgggcagatgcaggaaccaaaaaactggagtgt
acactacctgatggaactggacggcgtgtcattcaaaacaacctcaagtaccccttcagc
atcgtaagctatgcagatcacttctaccacacagactggaggagggatggtgttgtatca
gtaaataaacatagtggccagtttactgatgagtatctcccagaacaacgatctcacctc
tacgggataactgcagtctacccctactgcccaacaggaagaaagtaa

DBGET integrated database retrieval system