KEGG   Homo sapiens (human): 22796Help
Entry
22796             CDS       T01001                                 

Gene name
COG2, CDG2Q, LDLC
Definition
(RefSeq) component of oligomeric golgi complex 2
  KO
K20289  conserved oligomeric Golgi complex subunit 2
Organism
hsa  Homo sapiens (human)
Disease
H00119  Congenital disorders of glycosylation type II
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    22796 (COG2)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Tethering complex
   Conserved oligomeric Golgi (COG) complex
    22796 (COG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COG2 DUF3510 Vps51 DUF1664 COG5
Motif
Other DBs
NCBI-GeneID: 22796
NCBI-ProteinID: NP_031383
OMIM: 606974
HGNC: 6546
Ensembl: ENSG00000135775
Vega: OTTHUMG00000037753
Pharos: Q14746(Tbio)
UniProt: Q14746 B1ALW7
Position
1q42.2
AA seq 738 aa AA seqDB search
MEKSRMNLPKGPDTLCFDKDEFMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAM
VELINKDYADFVNLSTNLVGMDKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQ
EDIRKKKMCVLRLIQVIRSVEKIEKILNSQSSKETSALEASSPLLTGQILERIATEFNQL
QFHAVQSKGMPLLDKVRPRIAGITAMLQQSLEGLLLEGLQTSDVDIIRHCLRTYATIDKT
RDAEALVGQVLVKPYIDEVIIEQFVESHPNGLQVMYNKLLEFVPHHCRLLREVTGGAISS
EKGNTVPGYDFLVNSVWPQIVQGLEEKLPSLFNPGNPDAFHEKYTISMDFVRRLERQCGS
QASVKRLRAHPAYHSFNKKWNLPVYFQIRFREIAGSLEAALTDVLEDAPAESPYCLLASH
RTWSSLRRCWSDEMFLPLLVHRLWRLTLQILARYSVFVNELSLRPISNESPKEIKKPLVT
GSKEPSITQGNTEDQGSGPSETKPVVSISRTQLVYVVADLDKLQEQLPELLEIIKPKLEM
IGFKNFSSISAALEDSQSSFSACVPSLSSKIIQDLSDSCFGFLKSALEVPRLYRRTNKEV
PTTASSYVDSALKPLFQLQSGHKDKLKQAIIQQWLEGTLSESTHKYYETVSDVLNSVKKM
EESLKRLKQARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKLGLQASDIKSFS
ALAELVAAAKDQATAEQP
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaagtaggatgaacctgcccaaggggccggacacgctctgcttcgacaaggac
gagttcatgaaggaagatttcgatgtcgatcattttgtgtctgactgtaggaagcgggtc
cagctggaagaactgagagatgacctggagctctactataaacttcttaaaacagccatg
gtcgaactcatcaacaaggattatgcagattttgtcaatctttcaacaaacttggttggc
atggacaaagccctcaaccagctttctgtgcctttgggacaattacgagaagaggttctg
agccttagatcgtctgtcagtgaaggaattcgggcagttgatgaacgaatgtctaaacaa
gaggacattaggaaaaaaaagatgtgtgtattgaggcttatacaagttattcggtcagtt
gagaaaattgaaaaaatcttaaactctcaaagttctaaagaaacctctgcactagaagca
agcagcccccttttgactggacaaattttggagagaattgccacagaatttaatcagtta
cagtttcatgctgttcaaagcaaaggcatgcctcttttggacaaagtaagaccgcgtata
gctggcattacagccatgttacagcagtcactggaaggtctcctattagaaggccttcag
acgtctgacgtcgatataatacggcactgcttgcggacttacgccacgattgacaagaca
cgggacgcggaggccttagttggccaagtactagtgaaaccatacatagacgaggtgatt
atagagcagtttgttgaatctcatcccaatggccttcaggtcatgtataataaactcctg
gagtttgttcctcaccattgccgccttcttcgagaagtcacaggaggtgccatctccagt
gaaaaaggcaatactgttcctggatatgactttttggtgaattctgtttggccacaaata
gtacaaggattagaagaaaagttaccctcgctttttaatcctgggaatcccgatgcattt
catgagaaatataccataagtatggattttgtcagaagattggaacggcagtgtggatca
caggctagtgtaaagagattaagagcccatcctgcctatcacagcttcaataagaagtgg
aacttgcctgtttattttcaaataagatttagagaaatagcgggatccttagaagcagca
cttacagatgtcctggaagatgccccagctgaaagtccgtattgccttttggcttctcat
agaacttggagcagccttaggaggtgttggtcagatgagatgttcttgccattactggtg
catcgcctgtggagactcactctgcagattttggcacgatactctgtgtttgtcaatgag
ctttcactcaggcccatttctaatgaaagtcccaaggagatcaagaaacctttggtaact
ggtagcaaagaaccttccatcacccaaggaaacactgaagaccaaggaagtggtccttcg
gaaacaaagcctgtggtttccatttcccgcactcagctcgtgtatgtggttgcagacctg
gacaagcttcaggagcagcttccagaactcttggaaataatcaagccaaaacttgaaatg
attggctttaagaatttttcttctatctcagcagccctggaggactcccagagctctttt
tcagcctgtgtgccctccttgagtagcaagatcatccaggatttaagtgactcttgcttc
ggtttcctaaaaagcgccctggaggttcccaggctttaccgaagaaccaataaggaggtc
ccaaccacagcttcctcctatgtggacagtgctctgaagcccttattccagcttcagagc
ggacacaaggataagctcaaacaagcaataattcagcagtggctagaaggcactctcagt
gaaagcactcataagtactatgaaaccgtgtcagatgtattaaactctgtgaagaagatg
gaagagagcctgaaaaggctgaaacaagccagaaaaaccactcccgccaaccccgtcggt
cccagtggtggcatgagcgacgacgacaaaatcaggctgcagttggccctagatgttgag
tacttgggagagcagatacaaaagttgggactacaagcaagtgacataaaaagcttctca
gctctcgcagagcttgttgctgctgccaaggaccaggcaacagcagagcagccttaa

DBGET integrated database retrieval system