KEGG   Homo sapiens (human): 22797Help
Entry
22797             CDS       T01001                                 

Gene name
TFEC, TCFEC, TFE-C, TFEC-L, TFECL, bHLHe34, hTFEC-L
Definition
(RefSeq) transcription factor EC
  KO
K15591  transcription factor EC
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    22797 (TFEC)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    22797 (TFEC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3371 HLH
Motif
Other DBs
NCBI-GeneID: 22797
NCBI-ProteinID: NP_036384
OMIM: 604732
HGNC: 11754
Ensembl: ENSG00000105967
Vega: OTTHUMG00000023518
Pharos: O14948(Tbio)
UniProt: O14948
Position
7q31.2
AA seq 347 aa AA seqDB search
MTLDHQIINPTLKWSQPAVPSGGPLVQHAHTTLDSDAGLTENPLTKLLAIGKEDDNAQWH
MEDVIEDIIGMESSFKEEGADSPLLMQRTLSGSILDVYSGEQGISPINMGLTSASCPSSL
PMKREITETDTRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGT
ILKASVEYIKWLQKEQQRARELEHRQKKLEQANRRLLLRIQELEIQARTHGLPTLASLGT
VDLGAHVTKQQSHPEQNSVDYCQQLTVSQGPSPELCDQAIAFSDPLSYFTDLSFSAALKE
EQRLDGMLLDDTISPFGTDPLLSATSPAVSKESSRRSSFSSDDGDEL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgatcatcagatcatcaatccaactcttaaatggtcacaacctgcagtgcca
agtggtgggcctcttgtgcagcatgcacacacaactctggacagtgatgctggcctcaca
gaaaacccactcaccaagttactagctattgggaaagaagatgacaatgcacaatggcat
atggaggacgttattgaggatataatcggtatggaatcaagttttaaagaggaaggagca
gactctcctctgctaatgcaaagaacattatctggaagtattttggatgtgtatagcggt
gaacaaggaatttcaccaattaacatggggcttacaagtgcttcttgtccaagtagtcta
ccaatgaaaagagaaattacagaaactgacactagagctttagcaaaagagagacaaaaa
aaggacaaccacaacctcattgaaagaagaagaaggtataatattaattaccgaatcaag
gagcttggcactcttattccaaagtctaatgatcctgatatgcgctggaacaaaggaacc
attctaaaagcatcagtggagtacatcaagtggctacaaaaagaacaacagagagcccga
gaattggaacacagacagaagaaattagagcaggctaacaggcgacttctacttcggatt
caggaactagaaattcaggctcgtactcatggtctgccaaccctggcttcacttggcacg
gttgatttaggtgctcatgtcaccaaacagcagagccatcctgagcagaattcagtagac
tattgccaacaactgactgtgtctcaggggccaagccctgagctctgtgatcaagctata
gccttttctgatcctttgtcatacttcacagatttatcatttagtgctgcattgaaagag
gaacaaagattggatggcatgctattggatgacacaatctctccatttggaacagatcct
ctgctatctgccacttcccctgcagtttccaaagaaagcagtaggagaagtagctttagc
tcagatgatggtgatgaattataa

DBGET integrated database retrieval system