KEGG   Homo sapiens (human): 2280Help
Entry
2280              CDS       T01001                                 

Gene name
FKBP1A, FKBP-12, FKBP-1A, FKBP1, FKBP12, PKC12, PKCI2, PPIASE
Definition
(RefSeq) FKBP prolyl isomerase 1A
  KO
K09568  FK506-binding protein 1 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    2280 (FKBP1A)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     2280 (FKBP1A)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    2280 (FKBP1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 2280
NCBI-ProteinID: NP_000792
OMIM: 186945
HGNC: 3711
Ensembl: ENSG00000088832
Vega: OTTHUMG00000031666
Pharos: P62942(Tclin)
UniProt: P62942 Q0VDC6
Structure
PDB: 

Position
20p13
AA seq 108 aa AA seqDB search
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgcaggtggaaaccatctccccaggagacgggcgcaccttccccaagcgcggc
cagacctgcgtggtgcactacaccgggatgcttgaagatggaaagaaatttgattcctcc
cgggacagaaacaagccctttaagtttatgctaggcaagcaggaggtgatccgaggctgg
gaagaaggggttgcccagatgagtgtgggtcagagagccaaactgactatatctccagat
tatgcctatggtgccactgggcacccaggcatcatcccaccacatgccactctcgtcttc
gatgtggagcttctaaaactggaatga

DBGET integrated database retrieval system