KEGG   Homo sapiens (human): 22800Help
Entry
22800             CDS       T01001                                 

Gene name
RRAS2, TC21
Definition
(RefSeq) RAS related 2
  KO
K07830  Ras-related protein R-Ras2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04024  cAMP signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04218  Cellular senescence
hsa04371  Apelin signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05166  HTLV-I infection
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    22800 (RRAS2)
   04010 MAPK signaling pathway
    22800 (RRAS2)
   04371 Apelin signaling pathway
    22800 (RRAS2)
   04072 Phospholipase D signaling pathway
    22800 (RRAS2)
   04024 cAMP signaling pathway
    22800 (RRAS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    22800 (RRAS2)
   04137 Mitophagy - animal
    22800 (RRAS2)
  09143 Cell growth and death
   04218 Cellular senescence
    22800 (RRAS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    22800 (RRAS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    22800 (RRAS2)
 09160 Human Diseases
  09161 Cancers
   05205 Proteoglycans in cancer
    22800 (RRAS2)
  09167 Infectious diseases
   05166 HTLV-I infection
    22800 (RRAS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    22800 (RRAS2)
   04031 GTP-binding proteins [BR:hsa04031]
    22800 (RRAS2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   22800 (RRAS2)
  Exosomal proteins of bladder cancer cells
   22800 (RRAS2)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ras [OT]
    22800 (RRAS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 DUF2075
Motif
Other DBs
NCBI-GeneID: 22800
NCBI-ProteinID: NP_036382
OMIM: 600098
HGNC: 17271
Ensembl: ENSG00000133818
Vega: OTTHUMG00000165756
Pharos: P62070(Tbio)
UniProt: P62070
Structure
PDB: 

Position
11p15.2
AA seq 204 aa AA seqDB search
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDR
AARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEF
PMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE
QECPPSPEPTRKEKDKKGCHCVIF
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggccggctggcgggacggctccggccaggagaagtaccggctcgtggtggtc
ggcgggggcggcgtgggcaagtcggcgctcaccatccagttcatccagtcctattttgta
acggattatgatccaaccattgaagattcttacacaaagcagtgtgtgatagatgacaga
gcagcccggctagatattttggatacagcaggacaagaagagtttggagccatgagagaa
cagtatatgaggactggcgaaggcttcctgttggtcttttcagtcacagatagaggcagt
tttgaagaaatctataagtttcaaagacagattctcagagtaaaggatcgtgatgagttc
ccaatgattttaattggtaataaagcagatctggatcatcaaagacaggtaacacaggaa
gaaggacaacagttagcacggcagcttaaggtaacatacatggaggcatcagcaaagatt
aggatgaatgtagatcaagctttccatgaacttgtccgggttatcaggaaatttcaagag
caggaatgtcctccttcaccagaaccaacacggaaagaaaaagacaagaaaggctgccat
tgtgtcattttctag

DBGET integrated database retrieval system