KEGG   Homo sapiens (human): 22801Help
Entry
22801             CDS       T01001                                 

Gene name
ITGA11, HsT18964
Definition
(RefSeq) integrin subunit alpha 11
  KO
K06587  integrin alpha 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Network
N00393  ITGA/B-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    22801 (ITGA11)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    22801 (ITGA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22801 (ITGA11)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    22801 (ITGA11)
 09160 Human Diseases
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    22801 (ITGA11)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    22801 (ITGA11)
   05414 Dilated cardiomyopathy (DCM)
    22801 (ITGA11)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    22801 (ITGA11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    22801 (ITGA11)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   22801 (ITGA11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Ku_N Mur_ligase_C
Motif
Other DBs
NCBI-GeneID: 22801
NCBI-ProteinID: NP_001004439
OMIM: 604789
HGNC: 6136
Ensembl: ENSG00000137809
Vega: OTTHUMG00000172657
Pharos: Q9UKX5(Tbio)
UniProt: Q9UKX5 B3KTN6
Position
15q23
AA seq 1188 aa AA seqDB search
MDLPRGLVVAWALSLWPGFTDTFNMDTRKPRVIPGSRTAFFGYTVQQHDISGNKWLVVGA
PLETNGYQKTGDVYKCPVIHGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLA
CSPLWSHECGSSYYTTGMCSRVNSNFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVE
VQHFLINILKKFYIGPGQIQVGVVQYGEDVVHEFHLNDYRSVKDVVEAASHIEQRGGTET
RTAFGIEFARSEAFQKGGRKGAKKVMIVITDGESHDSPDLEKVIQQSERDNVTRYAVAVL
GYYNRRGINPETFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIFSLEGTNKNET
SFGLEMSQTGFSSHVVEDGVLLGAVGAYDWNGAVLKETSAGKVIPLRESYLKEFPEELKN
HGAYLGYTVTSVVSSRQGRVYVAGAPRFNHTGKVILFTMHNNRSLTIHQAMRGQQIGSYF
GSEITSVDIDGDGVTDVLLVGAPMYFNEGRERGKVYVYELRQNLFVYNGTLKDSHSYQNA
RFGSSIASVRDLNQDSYNDVVVGAPLEDNHAGAIYIFHGFRGSILKTPKQRITASELATG
LQYFGCSIHGQLDLNEDGLIDLAVGALGNAVILWSRPVVQINASLHFEPSKINIFHRDCK
RSGRDATCLAAFLCFTPIFLAPHFQTTTVGIRYNATMDERRYTPRAHLDEGGDRFTNRAV
LLSSGQELCERINFHVLDTADYVKPVTFSVEYSLEDPDHGPMLDDGWPTTLRVSVPFWNG
CNEDEHCVPDLVLDARSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRQRVAV
EATLENRGENAYSTVLNISQSANLQFASLIQKEDSDGSIECVNEERRLQKQVCNVSYPFF
RAKAKVAFRLDFEFSKSIFLHHLEIELAAGSDSNERDSTKEDNVAPLRFHLKYEADVLFT
RSSSLSHYEVKPNSSLERYDGIGPPFSCIFRIQNLGLFPIHGMMMKITIPIATRSGNRLL
KLRDFLTDEANTSCNIWGNSTEYRPTPVEEDLRRAPQLNHSNSDVVSINCNIRLVPNQEI
NFHLLGNLWLRSLKALKYKSMKIMVNAALQRQFHSPFIFREEDPSRQIVFEISKQEDWQV
PIWIIVGSTLGGLLLLALLVLALWKLGFFRSARRRREPGLDPTPKVLE
NT seq 3567 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccaggggcctggtggtggcctgggcgctcagcctgtggccagggttcacg
gacaccttcaacatggacaccaggaagccccgggtcatccctggctccaggaccgccttc
tttggctacacagtgcagcagcacgacatcagtggcaataagtggctggtcgtgggcgcc
ccactggaaaccaatggctaccagaagacgggagacgtgtacaagtgtccagtgatccac
gggaactgcaccaaactcaacctgggaagggtcaccctgtccaacgtgtccgagcggaaa
gacaacatgcgcctcggccttagtctcgccaccaaccccaaggacaacagcttcctggcc
tgcagccccctctggtctcatgagtgtgggagctcctactacaccacagggatgtgttca
agagtcaactccaacttcaggttctccaagaccgtggccccagctctccaaaggtgccag
acctacatggacatcgtcattgtcctggatggctccaacagcatctacccctgggtggag
gttcagcacttcctcatcaacatcctgaaaaagttttacattggcccagggcagatccag
gttggagttgtgcagtatggcgaagatgtggtgcatgagtttcacctcaacgactacagg
tctgtaaaagatgtggtggaagctgccagccacattgagcagagaggaggaacagagacc
cggacggcatttggcattgaatttgcacgctcagaggctttccagaagggtggaaggaaa
ggagccaagaaggtgatgattgtcatcacagatggggagtcccacgacagcccagacctg
gagaaggtgatccagcaaagcgaaagagacaacgtaacaagatatgcggtggccgtcctg
ggctactacaaccgcagggggatcaatccagaaacttttctaaatgaaatcaaatacatc
gccagtgaccctgatgacaagcacttcttcaatgtcactgatgaggctgccttgaaggac
attgtcgatgccctgggggacagaatcttcagcctggaaggcaccaacaagaacgagacc
tcctttgggctggagatgtcacagacgggcttttcctcgcacgtggtggaggatggggtt
ctgctgggagccgtcggtgcctatgactggaatggagctgtgctaaaggagacgagtgcc
gggaaggtcattcctctccgcgagtcctacctgaaagagttccccgaggagctcaagaac
catggtgcatacctggggtacacagtcacatcggtcgtgtcctccaggcaggggcgggtg
tacgtggccggagccccccggttcaaccacacgggcaaggtcatcctgttcaccatgcac
aacaaccggagcctcaccatccaccaggctatgcggggccagcagataggctcttacttt
gggagtgaaatcacctcggtggacatcgacggcgacggcgtgactgatgtcctgctggtg
ggcgcacccatgtacttcaacgagggccgtgagcgaggcaaggtgtacgtctatgagctg
agacagaacctgtttgtttataacggaacgctaaaggattcacacagttaccagaatgcc
cgatttgggtcctccattgcctcagttcgagacctcaaccaggattcctacaatgacgtg
gtggtgggagcccccctggaggacaaccacgcaggagccatctacatcttccacggcttc
cgaggcagcatcctgaagacacctaagcagagaatcacagcctcagagctggctaccggc
ctccagtattttggctgcagcatccacgggcaattggacctcaatgaggatgggctcatc
gacctggcagtgggagcccttggcaacgctgtgattctgtggtcccgcccagtggttcag
atcaatgccagcctccactttgagccatccaagatcaacatcttccacagagactgcaag
cgcagtggcagggatgccacctgcctggccgccttcctctgcttcacgcccatcttcctg
gcaccccatttccaaacaacaactgttggcatcagatacaacgccaccatggatgagagg
cggtatacaccgagggcccacctggacgagggcggggaccgattcaccaacagagccgta
ctgctctcctccggccaggagctctgtgagcggatcaacttccatgtcctggacactgct
gactacgtgaagccagtgaccttctcagtcgagtattccctggaggaccctgaccatggc
cccatgctggacgacggctggcccaccactctcagagtctcggtgcccttctggaacggc
tgcaatgaggatgagcactgtgtccctgaccttgtgttggatgcccggagtgacctgccc
acggccatggagtactgccagagggtgctgaggaagcctgcgcaggactgctccgcatac
acgctgtccttcgacaccacagtcttcatcatagagagcacacgccagcgagtggcggtg
gaggccacactggagaacaggggcgagaacgcctacagcacggtcctaaatatctcgcag
tcagcaaacctgcagtttgccagcttgatccagaaggaggactcagacggtagcattgag
tgtgtgaacgaggagaggaggctccagaagcaagtctgcaacgtcagctatcccttcttc
cgggccaaggccaaggtggctttccgtcttgattttgagttcagcaaatccatcttccta
caccacctggagatcgagctcgctgcaggcagtgacagtaatgagcgggacagcaccaag
gaagacaacgtggcccccttacgcttccacctcaaatacgaggctgacgtcctcttcacc
aggagcagcagcctgagccactacgaggtcaagcccaacagctcgctggagagatacgat
ggtatcgggcctcccttcagctgcatcttcaggatccagaacttgggcttgttccccatc
cacgggatgatgatgaagatcaccattcccatcgccaccaggagcggcaaccgcctactg
aagctgagggacttcctcacggacgaggcgaacacgtcctgtaacatctggggcaatagc
actgagtaccggcccaccccagtggaggaagacttgcgtcgtgctccacagctgaatcac
agcaactctgatgtcgtctccatcaactgcaatatacggctggtccccaaccaggaaatc
aatttccatctactggggaacctgtggttgaggtccctaaaagcactcaagtacaaatcc
atgaaaatcatggtcaacgcagccttgcagaggcagttccacagccccttcatcttccgt
gaggaggatcccagccgccagatcgtgtttgagatctccaagcaagaggactggcaggtc
cccatctggatcattgtaggcagcaccctggggggcctcctactgctggccctgctggtc
ctggcactgtggaagctcggcttctttagaagtgccaggcgcaggagggagcctggtctg
gaccccacccccaaagtgctggagtga

DBGET integrated database retrieval system