KEGG   Homo sapiens (human): 22802Help
Entry
22802             CDS       T01001                                 

Gene name
CLCA4, CaCC, CaCC2
Definition
(RefSeq) chloride channel accessory 4
  KO
K05030  calcium-activated chloride channel regulator 3/4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04924  Renin secretion
hsa04972  Pancreatic secretion
Drug target
Niflumic acid: D08275
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    22802 (CLCA4)
  Digestive system
   04972 Pancreatic secretion
    22802 (CLCA4)
Ion channels [BR:hsa04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   22802 (CLCA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CLCA VWA VWA_2
Motif
Other DBs
NCBI-GeneID: 22802
NCBI-ProteinID: NP_036260
OMIM: 616857
HGNC: 2018
Ensembl: ENSG00000016602
Vega: OTTHUMG00000010260
Pharos: Q14CN2(Tbio)
UniProt: Q14CN2
Position
1p22.3
AA seq 919 aa AA seqDB search
MGLFRGFVFLLVLCLLHQSNTSFIKLNNNGFEDIVIVIDPSVPEDEKIIEQIEDMVTTAS
TYLFEATEKRFFFKNVSILIPENWKENPQYKRPKHENHKHADVIVAPPTLPGRDEPYTKQ
FTECGEKGEYIHFTPDLLLGKKQNEYGPPGKLFVHEWAHLRWGVFDEYNEDQPFYRAKSK
KIEATRCSAGISGRNRVYKCQGGSCLSRACRIDSTTKLYGKDCQFFPDKVQTEKASIMFM
QSIDSVVEFCNEKTHNQEAPSLQNIKCNFRSTWEVISNSEDFKNTIPMVTPPPPPVFSLL
KISQRIVCLVLDKSGSMGGKDRLNRMNQAAKHFLLQTVENGSWVGMVHFDSTATIVNKLI
QIKSSDERNTLMAGLPTYPLGGTSICSGIKYAFQVIGELHSQLDGSEVLLLTDGEDNTAS
SCIDEVKQSGAIVHFIALGRAADEAVIEMSKITGGSHFYVSDEAQNNGLIDAFGALTSGN
TDLSQKSLQLESKGLTLNSNAWMNDTVIIDSTVGKDTFFLITWNSLPPSISLWDPSGTIM
ENFTVDATSKMAYLSIPGTAKVGTWAYNLQAKANPETLTITVTSRAANSSVPPITVNAKM
NKDVNSFPSPMIVYAEILQGYVPVLGANVTAFIESQNGHTEVLELLDNGAGADSFKNDGV
YSRYFTAYTENGRYSLKVRAHGGANTARLKLRPPLNRAAYIPGWVVNGEIEANPPRPEID
EDTQTTLEDFSRTASGGAFVVSQVPSLPLPDQYPPSQITDLDATVHEDKIILTWTAPGDN
FDVGKVQRYIIRISASILDLRDSFDDALQVNTTDLSPKEANSKESFAFKPENISEENATH
IFIAIKSIDKSNLTSKVSNIAQVTLFIPQANPDDIDPTPTPTPTPTPDKSHNSGVNISTL
VLSVIGSVVIVNFILSTTI
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atggggttattcagaggttttgttttcctcttagttctgtgcctgctgcaccagtcaaat
acttccttcattaagctgaataataatggctttgaagatattgtcattgttatagatcct
agtgtgccagaagatgaaaaaataattgaacaaatagaggatatggtgactacagcttct
acgtacctgtttgaagccacagaaaaaagattttttttcaaaaatgtatctatattaatt
cctgagaattggaaggaaaatcctcagtacaaaaggccaaaacatgaaaaccataaacat
gctgatgttatagttgcaccacctacactcccaggtagagatgaaccatacaccaagcag
ttcacagaatgtggagagaaaggcgaatacattcacttcacccctgaccttctacttgga
aaaaaacaaaatgaatatggaccaccaggcaaactgtttgtccatgagtgggctcacctc
cggtggggagtgtttgatgagtacaatgaagatcagcctttctaccgtgctaagtcaaaa
aaaatcgaagcaacaaggtgttccgcaggtatctctggtagaaatagagtttataagtgt
caaggaggcagctgtcttagtagagcatgcagaattgattctacaacaaaactgtatgga
aaagattgtcaattctttcctgataaagtacaaacagaaaaagcatccataatgtttatg
caaagtattgattctgttgttgaattttgtaacgaaaaaacccataatcaagaagctcca
agcctacaaaacataaagtgcaattttagaagtacatgggaggtgattagcaattctgag
gattttaaaaacaccatacccatggtgacaccacctcctccacctgtcttctcattgctg
aagatcagtcaaagaattgtgtgcttagttcttgataagtctggaagcatggggggtaag
gaccgcctaaatcgaatgaatcaagcagcaaaacatttcctgctgcagactgttgaaaat
ggatcctgggtggggatggttcactttgatagtactgccactattgtaaataagctaatc
caaataaaaagcagtgatgaaagaaacacactcatggcaggattacctacatatcctctg
ggaggaacttccatctgctctggaattaaatatgcatttcaggtgattggagagctacat
tcccaactcgatggatccgaagtactgctgctgactgatggggaggataacactgcaagt
tcttgtattgatgaagtgaaacaaagtggggccattgttcattttattgctttgggaaga
gctgctgatgaagcagtaatagagatgagcaagataacaggaggaagtcatttttatgtt
tcagatgaagctcagaacaatggcctcattgatgcttttggggctcttacatcaggaaat
actgatctctcccagaagtcccttcagctcgaaagtaagggattaacactgaatagtaat
gcctggatgaacgacactgtcataattgatagtacagtgggaaaggacacgttctttctc
atcacatggaacagtctgcctcccagtatttctctctgggatcccagtggaacaataatg
gaaaatttcacagtggatgcaacttccaaaatggcctatctcagtattccaggaactgca
aaggtgggcacttgggcatacaatcttcaagccaaagcgaacccagaaacattaactatt
acagtaacttctcgagcagcaaattcttctgtgcctccaatcacagtgaatgctaaaatg
aataaggacgtaaacagtttccccagcccaatgattgtttacgcagaaattctacaagga
tatgtacctgttcttggagccaatgtgactgctttcattgaatcacagaatggacataca
gaagttttggaacttttggataatggtgcaggcgctgattctttcaagaatgatggagtc
tactccaggtattttacagcatatacagaaaatggcagatatagcttaaaagttcgggct
catggaggagcaaacactgccaggctaaaattacggcctccactgaatagagccgcgtac
ataccaggctgggtagtgaacggggaaattgaagcaaacccgccaagacctgaaattgat
gaggatactcagaccaccttggaggatttcagccgaacagcatccggaggtgcatttgtg
gtatcacaagtcccaagccttcccttgcctgaccaatacccaccaagtcaaatcacagac
cttgatgccacagttcatgaggataagattattcttacatggacagcaccaggagataat
tttgatgttggaaaagttcaacgttatatcataagaataagtgcaagtattcttgatcta
agagacagttttgatgatgctcttcaagtaaatactactgatctgtcaccaaaggaggcc
aactccaaggaaagctttgcatttaaaccagaaaatatctcagaagaaaatgcaacccac
atatttattgccattaaaagtatagataaaagcaatttgacatcaaaagtatccaacatt
gcacaagtaactttgtttatccctcaagcaaatcctgatgacattgatcctacacctact
cctactcctactcctactcctgataaaagtcataattctggagttaatatttctacgctg
gtattgtctgtgattgggtctgttgtaattgttaactttattttaagtaccaccatttga

DBGET integrated database retrieval system