KEGG   Homo sapiens (human): 22809
Entry
22809             CDS       T01001                                 

Gene name
ATF5, ATFX, HMFN0395
Definition
(RefSeq) activating transcription factor 5
  KO
K09044  activating transcription factor 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    22809 (ATF5)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    22809 (ATF5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2
Other DBs
NCBI-GeneID: 22809
NCBI-ProteinID: NP_001180575
OMIM: 606398
HGNC: 790
Ensembl: ENSG00000169136
Vega: OTTHUMG00000183065
Pharos: Q9Y2D1(Tbio)
UniProt: Q9Y2D1 A0A024QZG3
Position
19q13.33
AA seq 282 aa
MSLLATLGLELDRALLPASGLGWLVDYGKLPPAPAPLAPYEVLGGALEGGLPVGGEPLAG
DGFSDWMTERVDFTALLPLEPPLPPGTLPQPSPTPPDLEAMASLLKKELEQMEDFFLDAP
PLPPPSPPPLPPPPLPPAPSLPLSLPSFDLPQPPVLDTLDLLAIYCRNEAGQEEVGMPPL
PPPQQPPPPSPPQPSRLAPYPHPATTRGDRKQKKRDQNKSAALRYRQRKRAEGEALEGEC
QGLEARNRELKERAESVEREIQYVKDLLIEVYKARSQRTRSC
NT seq 849 nt   +upstreamnt  +downstreamnt
atgtcactcctggcgaccctggggctggagctggacagggccctgctcccagctagtggg
ctgggatggctcgtagactatgggaaactccccccggcccctgcccccctggctccctat
gaggtccttgggggagccctggagggcgggcttccagtggggggagagcccctggcaggt
gatggcttctctgactggatgactgagcgagttgatttcacagctctcctccctctggag
cctcccttaccccccggcaccctcccccaaccttccccaaccccacctgacctggaagct
atggcctccctcctcaagaaggagctggaacagatggaagacttcttcctagatgccccg
cccctcccaccaccctccccgccgccactaccaccaccaccactaccaccagccccctcc
ctccccctgtccctcccctcctttgacctcccccagccccctgtcttggatactctggac
ttgctggccatctactgccgcaacgaggccgggcaggaggaagtggggatgccgcctctg
cccccgccacagcagccccctcctccttctccacctcaaccttctcgcctggccccctac
ccacatcctgccaccacccgaggggaccgcaagcaaaagaagagagaccagaacaagtcg
gcggctctgaggtaccgccagcggaagcgggcagagggtgaggccctggagggcgagtgc
caggggctggaggcacggaatcgcgagctgaaggaacgggcagagtccgtggagcgcgag
atccagtacgtcaaggacctgctcatcgaggtttacaaggcccggagccagaggacccgt
agctgctag

DBGET integrated database retrieval system