KEGG   Homo sapiens (human): 22818
Entry
22818             CDS       T01001                                 

Gene name
COPZ1, CGI-120, COPZ, HSPC181, zeta-COP, zeta1-COP
Definition
(RefSeq) COPI coat complex subunit zeta 1
  KO
K20472  coatomer subunit zeta
Organism
hsa  Homo sapiens (human)
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01293  COPI vesicle formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    22818 (COPZ1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    22818 (COPZ1)
SSDB
Motif
Pfam: Clat_adaptor_s
Other DBs
NCBI-GeneID: 22818
NCBI-ProteinID: NP_057141
OMIM: 615472
HGNC: 2243
Ensembl: ENSG00000111481
Vega: OTTHUMG00000169762
Pharos: P61923(Tbio)
UniProt: P61923 A0A024RB72
Structure
PDB: 
5MC7 2HF6

Position
12q13.13
AA seq 177 aa
MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIA
LLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEG
LFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR
NT seq 534 nt   +upstreamnt  +downstreamnt
atggaggcgctgattttggaaccttccctgtatactgtcaaagccatcctgattctggac
aatgatggagatcgactttttgccaagtactatgacgacacctaccccagtgtcaaggag
caaaaggcctttgagaagaacattttcaacaagacccatcggactgacagtgaaattgcc
ctcttggaaggcctgacagtggtatacaaaagcagtatagatctctatttctatgtgatt
ggcagctcctatgaaaatgagctgatgcttatggctgttctgaactgtctcttcgactca
ttgagccagatgctgaggaaaaatgtagaaaagcgagcactgctggagaacatggagggg
ctgttcttggctgtggatgaaattgtagatggaggggtgatcctagagagtgatccccag
caggtggtacaccgggtggcattaaggggtgaagatgtcccccttacggagcagaccgtg
tctcaggtgctgcagtcagccaaagaacagatcaagtggtcactccttcggtga

DBGET integrated database retrieval system