KEGG   Homo sapiens (human): 22820
Entry
22820             CDS       T01001                                 
Symbol
COPG1, COPG
Name
(RefSeq) COPI coat complex subunit gamma 1
  KO
K17267  coatomer subunit gamma
Organism
hsa  Homo sapiens (human)
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01293  COPI vesicle formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    22820 (COPG1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    22820 (COPG1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    22820 (COPG1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   22820 (COPG1)
SSDB
Motif
Pfam: Adaptin_N COP-gamma_platf Coatomer_g_Cpla HEAT_2 Cnd1 PDS5 MOR2-PAG1_C UNC45-central
Other DBs
NCBI-GeneID: 22820
NCBI-ProteinID: NP_057212
OMIM: 615525
HGNC: 2236
Ensembl: ENSG00000181789
Pharos: Q9Y678(Tbio)
UniProt: Q9Y678
Structure
Position
3:129249606..129277773
AA seq 874 aa
MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTKILYLINQGEH
LGTTEATEAFFAMTKLFQSNDPTLRRMCYLTIKEMSCIAEDVIIVTSSLTKDMTGKEDNY
RGPAVRALCQITDSTMLQAIERYMKQAIVDKVPSVSSSALVSSLHLLKCSFDVVKRWVNE
AQEAASSDNIMVQYHALGLLYHVRKNDRLAVNKMISKVTRHGLKSPFAYCMMIRVASKQL
EEEDGSRDSPLFDFIESCLRNKHEMVVYEAASAIVNLPGCSAKELAPAVSVLQLFCSSPK
AALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGSESSIDRL
MKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEYKRAIVDC
IISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTTNPSKYIRFIYNRV
VLEHEEVRAGAVSALAKFGAQNEEMLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQK
ALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPLATAPMAEQRTESTPITAVK
QPEKVAATRQEIFQEQLAAVPEFRGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMV
FQFDCTNTLNDQTLENVTVQMEPTEAYEVLCYVPARSLPYNQPGTCYTLVALPKEDPTAV
ACTFSCMMKFTVKDCDPTTGETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVG
DEFEKEETFTLSTIKTLEEAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDI
LVRSRLLLLDTVTMQVTARSLEELPVDIILASVG
NT seq 2625 nt   +upstreamnt  +downstreamnt
atgttgaagaaattcgacaagaaggatgaggagtcaggtggaggctccaacccattccag
caccttgagaagagtgcggtactccaggaggcccgtgtatttaatgaaactcccatcaac
cctcggaaatgtgcccacatcctcaccaagattctttatctcataaaccagggggagcac
ctggggaccacggaagcgaccgaggccttctttgccatgaccaagctctttcagtccaat
gatcccacactccgtcggatgtgctacttgaccatcaaggagatgtcttgcattgcagag
gatgtcatcattgtcaccagcagcctaacaaaagacatgactgggaaagaagacaactac
cggggcccggccgtgcgagccctctgccagatcactgatagcaccatgctgcaggctatt
gagcgctacatgaaacaagccattgtggacaaggtgcccagtgtctccagctctgccctc
gtgtcttccttgcacctgctgaagtgcagctttgacgtggtcaagcgctgggtgaatgag
gctcaggaggcagcatccagtgataacatcatggtccagtaccacgcactagggctcctg
taccatgtgcgtaagaatgaccgcctagccgtcaataagatgatcagcaaggtcacacgg
catggccttaagtctccctttgcctactgcatgatgatccgggtggccagcaagcagctg
gaagaggaggatggcagccgtgacagcccactgtttgacttcatcgagagctgcttgcgc
aacaagcacgagatggtggtgtatgaagccgcctcggccatcgtcaatctgccaggctgc
agtgccaaagagctggccccggctgtgtcagtgctccagcttttctgcagctcacccaag
gctgctctccgctatgctgctgttcgtaccctcaataaggttgccatgaagcatccgtca
gctgtgacagcttgtaatctggatctggagaacctggtcacagattcaaaccgcagcatt
gccacgctggccatcaccaccctccttaagacgggcagcgagagcagcatcgaccgcctc
atgaagcagatctcctccttcatgtcagaaatctcggatgaattcaaggtggtggttgtc
caggccatcagtgccctgtgtcagaaatatcctcgcaaacacgccgtccttatgaacttc
ctgttcaccatgctgcgggaagagggtggctttgagtataagcgcgctatcgtggactgc
atcatcagcatcattgaagagaactcagagagcaaggagacagggctgtcacatctgtgc
gagttcatcgaggactgcgagttcacagtgctggccacccgtattctacatctcctgggc
caggaggggcccaagaccaccaatccctcaaagtacatccgcttcatctataaccgagtg
gtcttggagcatgaggaggtccgggcaggtgctgtgagtgctctggcgaagtttggagcc
cagaatgaagagatgttacccagtatcttggtgttgctgaagaggtgtgtgatggatgat
gacaatgaagtaagggaccgagccaccttctacctaaatgtcctggagcagaagcagaag
gcccttaatgcaggctatatcctaaatggtctgactgtgtccatccctggtctggagagg
gctctgcagcagtacactctagaaccatcagaaaaaccttttgacctcaagtctgtgccc
ctggccacggcgcccatggcagagcagagaacagaaagtacccccatcacagcagtcaaa
cagcctgagaaagtggcagctaccaggcaggagatcttccaggagcagttggcagcagtg
ccagagttccgcggtcttgggcccctcttcaagtcctcgcctgagcccgtggccctcacc
gagtcagagacggagtatgtcatccgctgcaccaaacacaccttcaccaaccacatggtt
tttcagtttgactgcacaaacacactcaatgaccagaccttggagaatgtcacagtgcag
atggagcccactgaggcctatgaggtgctctgttacgtgcctgcccggagcctgccctac
aaccagcccgggacctgctacacactggtggcactgcccaaagaagaccccacagctgtg
gcctgcacattcagctgcatgatgaagttcactgtcaaggactgtgatcccaccactggg
gagactgatgacgaaggctatgaggatgagtatgtgctggaagatctggaagttactgta
gctgatcacattcaaaaggtcatgaaactgaacttcgaagcagcctgggatgaggtaggg
gatgaatttgagaaggaggaaacgttcaccttgtctaccatcaagacacttgaagaggct
gtgggtaatattgtgaagttcttgggaatgcacccttgtgagaggtcagacaaagtgccg
gataacaagaacacccacacgttgctcctggctggtgtgttccggggtggtcatgacatc
ctggtgcgctcccggctgctgcttttggacacagtgacaatgcaggtgacagccagaagt
ttggaggagctgccagtagacatcatcttggcatctgtgggataa

DBGET integrated database retrieval system