KEGG   Homo sapiens (human): 22826Help
Entry
22826             CDS       T01001                                 

Gene name
DNAJC8, HSPC331, SPF31
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C8
  KO
K09528  DnaJ homolog subfamily C member 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    22826 (DNAJC8)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    22826 (DNAJC8)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    22826 (DNAJC8)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   22826 (DNAJC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ RPT DUF3089
Motif
Other DBs
NCBI-GeneID: 22826
NCBI-ProteinID: NP_055095
HGNC: 15470
Ensembl: ENSG00000126698
Vega: OTTHUMG00000003538
Pharos: O75937(Tdark)
UniProt: O75937
Position
1p35.3
AA seq 253 aa AA seqDB search
MAASGESGTSGGGGSTEEAFMTFYSEVKQIEKRDSVLTSKNQIERLTRPGSSYFNLNPFE
VLQIDPEVTDEEIKKRFRQLSILVHPDKNQDDADRAQKAFEAVDKAYKLLLDQEQKKRAL
DVIQAGKEYVEHTVKERKKQLKKEGKPTIVEEDDPELFKQAVYKQTMKLFAELEIKRKER
EAKEMHERKRQREEEIEAQEKAKREREWQKNFEESRDGRVDSWRNFQANTKGKKEKKNRT
FLRPPKVKMEQRE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttcaggagagagcgggacttcaggcggcggaggcagcaccgaggaagcattt
atgaccttctacagtgaggtgaaacaaatagagaagagagactcggttctaacttcgaaa
aatcagattgaaagactgacccgtcctggttcctcttacttcaatttgaacccatttgag
gttcttcagatagatcctgaagttacagatgaagaaataaaaaagaggtttcggcagtta
tccatcttggtgcatcctgacaaaaatcaagatgatgctgacagagcacaaaaggctttt
gaagctgtggacaaagcttacaagttgctactggatcaggagcaaaagaagagggccctg
gatgtaattcaggcaggaaaagaatacgtggaacacactgtgaaagagcgaaaaaaacaa
ttaaagaaggaaggaaaacctacaattgtagaggaggatgatcctgagctgttcaaacaa
gctgtatataaacagacaatgaaactctttgcagagctggaaattaaaaggaaagagaga
gaagccaaagagatgcatgaaaggaaacgacaaagggaagaagagattgaagctcaagaa
aaagccaaacgggaaagagagtggcagaaaaactttgaggaaagtcgagatggtcgtgtg
gacagctggcgaaacttccaagccaatacgaaggggaagaaagagaagaaaaatcggacc
ttcctgagaccaccgaaagtaaaaatggagcaacgtgagtga

DBGET integrated database retrieval system