KEGG   Homo sapiens (human): 22841
Entry
22841             CDS       T01001                                 

Gene name
RAB11FIP2, Rab11-FIP2, nRip11
Definition
(RefSeq) RAB11 family interacting protein 2
  KO
K12484  Rab11 family-interacting protein 1/2/5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    22841 (RAB11FIP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    22841 (RAB11FIP2)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    22841 (RAB11FIP2)
SSDB
Motif
Pfam: C2 RBD-FIP
Other DBs
NCBI-GeneID: 22841
NCBI-ProteinID: NP_055719
OMIM: 608599
HGNC: 29152
Ensembl: ENSG00000107560
Vega: OTTHUMG00000019128
Pharos: Q7L804(Tbio)
UniProt: Q7L804
Structure
PDB: 
3TSO 4C4P 2GZD 2GZH 2K6S

Position
10q26.11
AA seq 512 aa
MMLSEQAQKWFPTHVQVTVLQAKDLKPKGKSGTNDTYTIIQLGKEKYSTSVAEKTLEPVW
KEEASFELPGLLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF
RLESKQGKRIKNRGEIKVNIQFMRNNMTASMFDLSMKDKTRSPFAKLKDKMKGRKNDGTF
SDTSSAIIPSTHMPDANSEFSSGEIQMKSKPKKPFLLGPQRLSSAHSMSDLSGSHMSSEK
LKAGTIGQTHLLGHQLDSFGTVPESGSLKSPHRRTLSFDTSKMNQPDSIVDEGELCFGRQ
NDPFTNVTASLPQKFATLPRKKNPFEESSETWDSSMNLFSKPIEIRKENKREKREKVSLF
ERVTGKKDSRRSDKLNNGGSDSPCDLKSPNAFSENRQDYFDYESTNPFTAKFRASNIMPS
SSFHMSPTSNEDLRKIPDSNPFDATAGYRSLTYEEVLQELVKHKELLRRKDTHIRELEDY
IDNLLVRVMEETPSILRVPYEPSRKAGKFSNS
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgatgctgtccgagcaagcccaaaagtggtttccaacccacgtgcaggtcacagtgctc
caagccaaagatctgaagccaaaaggcaaaagtggtaccaatgacacatacactataatt
cagctgggcaaggaaaagtactccacctctgtagctgagaaaacccttgagccagtttgg
aaggaggaggcctctttcgagctacctggattgctaattcagggaagtccagagaaatac
attcttttccttatagttatgcacaggtccctggtgggtctggataaatttttagggcag
gtggcaatcaatctcaatgacatctttgaggacaaacaaagaaggaaaacagagtggttt
agattagaatccaaacaaggaaaacgaatcaaaaacaggggtgagataaaggtcaatatt
cagtttatgaggaacaatatgaccgcaagtatgtttgacttatcaatgaaggacaaaacc
agatctccttttgcaaagttaaaagataagatgaagggtagaaaaaatgatggaacattt
tctgatacgtcttctgcaatcattccaagtactcacatgcccgatgccaatagtgaattt
tcaagtggtgaaatacagatgaaatccaaaccaaaaaagccttttctcttgggtcctcag
cgactctcgtcagcgcattcaatgtctgatttatctgggtcccatatgtcttctgagaaa
ctgaaggctggcaccataggtcaaacacatcttctcggacaccagttagattcctttgga
acagttccagaaagtggaagtctcaaatctccacacagaagaacattaagctttgatact
tctaaaatgaaccaacctgacagcattgtggatgaaggtgaattgtgtttcggaagacaa
aatgacccatttacaaatgtgactgcttcattaccccaaaaatttgcaacactgccaagg
aagaaaaatccatttgaagaaagcagcgaaacatgggacagcagcatgaatttattttca
aaaccaattgaaataagaaaagaaaataaaagagagaaaagggagaaagttagcctgttt
gaaagagtgactggaaaaaaagatagcagaagatctgataaacttaacaatgggggatct
gatagcccttgtgacttgaaatcacctaatgcatttagtgaaaatcgccaggactatttt
gattatgagtcaaccaatccatttacagcaaaattcagggcttcaaatataatgccatct
tcaagttttcatatgagtccaacaagcaatgaagacctcaggaaaatcccggacagcaac
ccctttgatgccactgcagggtatcgtagtctgacctatgaagaggttctacaggagctg
gtgaaacacaaagaactccttaggaggaaagacacccacatccgggaactcgaggactac
atcgacaacctccttgtaagggtaatggaagaaacgcccagtattctcagagtgccgtat
gaaccatccaggaaagctggcaaattctctaacagttaa

DBGET integrated database retrieval system