KEGG   Homo sapiens (human): 22846
Entry
22846             CDS       T01001                                 

Gene name
VASH1, KIAA1036, TTCP_1
Definition
(RefSeq) vasohibin 1
  KO
K23355  tubulinyl-Tyr carboxypeptidase [EC:3.4.17.17]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    22846 (VASH1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.17  tubulinyl-Tyr carboxypeptidase
     22846 (VASH1)
SSDB
Motif
Pfam: Vasohibin
Other DBs
NCBI-GeneID: 22846
NCBI-ProteinID: NP_055724
OMIM: 609011
HGNC: 19964
Ensembl: ENSG00000071246
Vega: OTTHUMG00000171493
Pharos: Q7L8A9(Tbio)
UniProt: Q7L8A9
Structure
PDB: 

Position
14q24.3
AA seq 365 aa
MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPF
FVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPE
RLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGIYLT
NSMPTLERFPISFKTYFSGNYFRHIVLGVNFAGRYGALGMSRREDLMYKPPAFRTLSELV
LDFEAAYGRCWHVLKKVKLGQSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARD
MRLKIGKGTGPPSPTKDRKKDVSSPQRAQSSPHRRNSRSERRPSGDKKTSEPKAMPDLNG
YQIRV
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgccaggggggaagaaggtggctgggggtggcagcagcggtgccactccaacgtccgct
gcggccaccgccccctctggggtcaggcgtttggagaccagcgaaggaacctcagcccag
agagatgaggagccagaagaggaaggggaagaggacctgcgagacggaggcgtccccttc
tttgtcaaccggggtgggctacctgtggatgaggccacctgggaaaggatgtggaaacac
gtggccaagatccaccccgatggagagaaggtggcgcaacggatccgtggggccacagac
ctgcccaagatccccataccgagtgtgcctacgttccagccgtctacacctgtccctgag
cgcctggaagctgtgcagcgctacatcagagagctgcagtacaatcacacagggacacag
ttctttgaaattaagaagagcagacctctgacagggctgatggacctggccaaggaaatg
accaaagaggccctgccaatcaaatgcctggaagccgtgatcctgggaatttacctcacc
aacagcatgcccaccctggagcgcttccccatcagcttcaagacctacttctcagggaac
tacttccgccacatcgtgctgggggtgaacttcgcgggccgctacggtgcgctgggcatg
agtcggcgcgaggacctgatgtacaagccgcccgccttccgcacgctcagcgagctcgtg
ctggacttcgaggccgcctacggccgctgctggcacgtgctcaagaaggtgaagctgggc
cagagcgtgtcacacgacccgcacagcgtggagcagatcgagtggaagcactcggtgctg
gacgtggagcgcctgggccgcgatgacttccgcaaggagctggagcgccacgcccgcgac
atgcggctcaagattggcaaagggacgggccctccctctcccaccaaggaccggaagaag
gatgtttcttccccgcagcgggcccagtccagcccccaccgcaggaacagccgcagtgaa
agacggccctcgggtgacaagaagacttccgagcccaaagccatgccagaccttaacggg
taccagatccgggtctga

DBGET integrated database retrieval system