KEGG   Homo sapiens (human): 22853Help
Entry
22853             CDS       T01001                                 

Gene name
LMTK2, AATYK2, BREK, KPI-2, KPI2, LMR2, PPP1R100, cprk, hBREK
Definition
(RefSeq) lemur tyrosine kinase 2
  KO
K08898  lemur tyrosine kinase 2 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    22853 (LMTK2)
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    22853 (LMTK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     22853 (LMTK2)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  LMR family [OT]
   22853 (LMTK2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     22853 (LMTK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Kdo
Motif
Other DBs
NCBI-GeneID: 22853
NCBI-ProteinID: NP_055731
OMIM: 610989
HGNC: 17880
Ensembl: ENSG00000164715
Vega: OTTHUMG00000154256
Pharos: Q8IWU2(Tbio)
UniProt: Q8IWU2
Position
7q21.3
AA seq 1503 aa AA seqDB search
MPGPPALRRRLLLLLLVLLIAGSAGAAPLPQTGAGEAPPAAEVSSSFVILCVCSLIILIV
LIANCVSCCKDPEIDFKEFEDNFDDEIDFTPPAEDTPSVQSPAEVFTLSVPNISLPAPSQ
FQPSVEGLKSQVARHSLNYIQEIGNGWFGKVLLGEIYTGTSVARVIVKELKASANPKEQD
TFLKNGEPYYILQHPNILQCVGQCVEAIPYLLVFEFCDLGDLKAYLRSEQEHMRGDSQTM
LLQRMACEVAAGLAAMHKLHFLHSDLALRNCFLTSDLNVKVGDYGIGFSRYKEDYIETDD
KKVFPLRWTAPELVTSFQDRLLTADQTKYSNIWSLGVTLWELFDNAAQPYSNLSNLDVLN
QVIRERDTKLPKPQLEQPYSDRWYEVLQFCWLSPEKRPAAEDVHRLLTYLRLQSQRDSEV
DFEQQWNALKPNTNSRDSSNNAAFPILDHFARDRLGREMEEVLTVTETSQGLSFEYVWEA
AKHDHFDERSRGHLDEGLSYTSIFYPVEVFESSLSDPGPGKQDDSGQDVPLRVPGVVPVF
DAHNLSVGSDYYIQLEEKSGSNLELDYPPALLTTDMDNPERTGPELSQLTALRSVELEES
STDEDFFQSSTDPKDSSLPGDLHVTSGPESPFNNIFNDVDKSEDLPSHQKIFDLMELNGV
QADFKPATLSSSLDNPKESVITGHFEKEKPRKIFDSEPLCLSDNLMHQDNFDPLNVQELS
ENFLFLQEKNLLKGSLSSKEHINDLQTELKNAGFTEAMLETSCRNSLDTELQFAENKPGL
SLLQENVSTKGDDTDVMLTGDTLSTSLQSSPEVQVPPTSFETEETPRRVPPDSLPTQGET
QPTCLDVIVPEDCLHQDISPDAVTVPVEILSTDARTHSLDNRSQDSPGESEETLRLTESD
SVLADDILASRVSVGSSLPELGQELHNKPFSEDHHSHRRLEKNLEAVETLNQLNSKDAAK
EAGLVSALSSDSTSQDSLLEDSLSAPFPASEPSLETPDSLESVDVHEALLDSLGSHTPQK
LVPPDKPADSGYETENLESPEWTLHPAPEGTADSEPATTGDGGHSGLPPNPVIVISDAGD
GHRGTEVTPETFTAGSQGSYRDSAYFSDNDSEPEKRSEEVPGTSPSALVLVQEQPLPEPV
LPEQSPAAQDSCLEARKSQPDESCLSALHNSSDLELRATPEPAQTGVPQQVHPTEDEASS
PWSVLNAELSSGDDFETQDDRPCTLASTGTNTNELLAYTNSALDKSLSSHSEGPKLKEPD
IEGKYLGKLGVSGMLDLSEDGMDADEEDENSDDSDEDLRAFNLHSLSSESEDETEHPVPI
ILSNEDGRHLRSLLKPTAANAPDPLPEDWKKEKKAVTFFDDVTVYLFDQETPTKELGPCG
GEACGPDLSGPAPASGSPYLSRCINSESSTDEEGGGFEWDDDFSPDPFMSKTTSNLLSSK
PSLQTSKYFSPPPPARSTEQSWPHSAPYSRFSISPANIASFSLTHLTDSDIEQGGSSEDG
EKD
NT seq 4512 nt NT seq  +upstreamnt  +downstreamnt
atgccggggccgccggcgttgcggcggaggctgctgctgctgctgctggtcctcctgatc
gccggcagtgctggggccgcgccacttccgcaaacaggtgcaggggaggcgccacctgct
gcagaagtttcctcatcttttgtgatcctgtgtgtgtgcagtttaataatattaatagtg
ttaattgcaaactgtgtatcctgctgtaaggacccagaaatagactttaaggaatttgaa
gataattttgatgatgagatagatttcacaccaccagcagaagacactccctctgttcag
tccccagcagaggtcttcacactttcagtaccaaatatttcactcccagctccctcgcaa
ttccagccttctgtagagggattgaagtctcaagttgcccgccacagtctaaactacata
caggaaattggaaatggctggtttggaaaggttctcttgggagagatttacacgggcact
agcgtagcaagagtcatcgtgaaggagttaaaagcaagtgccaacccaaaggaacaagat
acttttttgaaaaatggagaaccttactacattcttcagcatccaaatattcttcagtgt
gttggacagtgcgtagaagcgattccctacctcctggtgtttgagttctgtgacttgggt
gacctgaaggcgtatctgcgcagcgagcaggagcacatgcggggggactcacagaccatg
ctgctgcagaggatggcgtgcgaggtcgccgcggggctggccgccatgcacaagctgcac
ttcctgcacagtgatttagccctgcggaattgttttctcacctccgacttaaatgtgaaa
gtgggagattacggaataggattcagcaggtacaaggaggattatattgaaacagatgat
aaaaaagttttccctctgcgatggactgctccagaattagtaaccagctttcaagacaga
ctgctaactgcagatcagactaagtatagtaatatctggtctctgggtgtgacactttgg
gagctttttgacaatgccgcacagccgtattcaaacctttccaacttagatgtcctcaac
caagtcattagagagagagacacaaaactcccgaagccccagctggagcagccctactct
gatagatggtatgaagtcttacagttctgttggctgtcaccagaaaagagacccgcggct
gaagatgtgcacaggctgctgacttacctgcggctgcagagccagcgggactcagaggtc
gactttgaacagcagtggaacgctctgaagccgaacacaaacagcagagactcctccaac
aatgctgcattcccaattctcgaccactttgccagggaccggctgggtcgtgaaatggag
gaagtcctcaccgtgaccgaaaccagccagggcctgagcttcgagtatgtctgggaggcc
gctaagcacgaccactttgacgagcgcagccggggccacctggacgaaggcttgtcctac
acgagcatcttctatccggttgaagtttttgagagttcgctttcagatcctgggcccgga
aagcaagatgacagcggccaggatgtccccctgagggtccctggagtggttcctgttttt
gatgcccacaacctttctgttggaagcgactattatatccagttagaagaaaaaagtggt
agtaacttggagcttgattacccaccagcgctgctcacaaccgacatggataatccagaa
aggactggccctgaactgtcccagctcacggcgctcaggagcgttgaacttgaggagtcc
agtacagatgaggacttcttccaaagcagtacagaccccaaagactctagcttaccaggg
gacttacacgtgaccagtggccccgagagccctttcaacaatatatttaatgatgtggac
aaatcggaagatttgcccagtcaccaaaaaatattcgacttaatggaattaaacggagtt
caagccgactttaaacctgccactttaagttccagtttggataaccccaaagagtcagtc
ataacaggccactttgagaaagaaaagccccgtaagatttttgacagtgagcctctctgc
ctatcagataatcttatgcaccaagataattttgatccattgaatgttcaagaattgtca
gaaaactttttatttcttcaagagaaaaacttactaaaaggctcattgtccagcaaagaa
cacataaatgatcttcagacagaacttaagaatgctggttttactgaagctatgttagaa
acgtcatgtagaaactctttagatactgagcttcagtttgctgaaaataagccaggcttg
tctttgttgcaggaaaacgtaagcacaaagggtgacgatacagatgtcatgctcacaggt
gacactttgagcacctcattgcagtcttccccggaagtgcaggtacctcctacctccttc
gaaacagaagaaacgccccgtcgggtacccccagactcactcccaacacagggagaaacc
cagcccacgtgtttagatgttattgtcccggaggactgtctccaccaggacatcagtcca
gacgctgtgactgtcccggttgaaattctctcaactgatgccagaacccacagcctggat
aacaggtcccaggactctcctggcgagagtgaggagaccctgcgactcaccgaaagtgac
tctgttcttgctgatgacatccttgccagcagggtgagtgtagggagtagtctcccggaa
ctgggacaggaattgcacaataaaccattttcggaagaccatcacagtcatcgccggcta
gagaaaaacttagaggctgtggagactttaaatcagctcaattctaaagacgcagcaaaa
gaagcaggcttggtgtctgccctctcctcggactcaaccagtcaggacagcctcctggag
gacagcttgtcagcacccttcccagcctctgagccgtccctggaaaccccggactctctg
gagtcagtggatgtccacgaagcgctactggactctttaggatctcacactccccagaaa
ctagtgccccccgataagccggcagacagtggctacgaaacagagaacttggagtctccc
gagtggaccttgcatcccgctcccgagggcaccgcagactcagaaccagccaccacgggc
gatggcggccacagcggtctgcctcccaacccggtcattgtcatctcagatgccggcgat
ggtcacagaggcacagaagtgacccctgagacgttcacagctggctcccagggttcatac
cgagactctgcgtacttctcagacaatgactctgagcccgagaaaaggtctgaggaggtc
ccgggaacctccccatccgccttggtgttggtacaggagcagcccctacccgagccagtc
ctccccgagcaaagtcctgctgcccaggatagctgcctggaagccagaaagagccagcca
gatgaaagttgtctgtctgctttgcacaactccagtgacctggaattaagagccacgccg
gagccagcacagactggtgttccccagcaggtgcatcccacggaagacgaggccagcagt
ccctggagtgtgctgaatgcagaacttagcagcggcgatgacttcgagacacaggacgat
cgcccctgcaccctcgcttccacggggaccaacacgaacgaactccttgcctacaccaat
tctgcgctggacaagtccctgtccagccactccgagggcccgaagttgaaggagccggac
atcgaagggaagtacctggggaaactcggggtgtcagggatgctcgacctctcagaggac
gggatggatgcagacgaggaggacgaaaacagcgacgactcggacgaggacctgcgggcc
ttcaacctgcatagcctcagctccgagtcggaggacgagaccgagcaccccgtgcccatc
atcctcagcaacgaggacggaaggcacctgcggagtctgttgaagcccacagcggccaat
gcccccgacccactgcccgaggactggaagaaggaaaagaaggcagtcacgtttttcgat
gatgtcacagtctacctgtttgaccaggagaccccaaccaaagagctggggccctgtgga
ggagaggcgtgcggcccggacctgagcggcccagccccagcctcaggctctccctacctg
agcaggtgcatcaactccgaaagctccaccgacgaagaaggtggtggctttgagtgggat
gatgacttctccccagatccttttatgtcaaagacaacaagtaacctgctcagctccaag
ccttctctccaaacatccaagtacttttctccgccgccaccggcccggagcacggagcag
agctggccgcactcggcgccttactcccggttctccatctctcccgccaacattgccagc
ttttccctcacacacctgaccgactcggacatcgagcagggcggaagcagcgaagacgga
gaaaaggactag

DBGET integrated database retrieval system