KEGG   Homo sapiens (human): 22856
Entry
22856             CDS       T01001                                 

Gene name
CHSY1, CHSY, CSS1, ChSy-1, TPBS
Definition
(RefSeq) chondroitin sulfate synthase 1
  KO
K13499  chondroitin sulfate synthase [EC:2.4.1.175 2.4.1.226]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
hsa01100  Metabolic pathways
Module
hsa_M00058  Glycosaminoglycan biosynthesis, chondroitin sulfate backbone
Disease
H01497  Temtamy preaxial brachydactyly syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    22856 (CHSY1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    22856 (CHSY1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.175  glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase
     22856 (CHSY1)
    2.4.1.226  N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase
     22856 (CHSY1)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   22856 (CHSY1)
SSDB
Motif
Pfam: CHGN Fringe Glyco_transf_7C Glyco_tranf_2_2 Galactosyl_T BMFP
Other DBs
NCBI-GeneID: 22856
NCBI-ProteinID: NP_055733
OMIM: 608183
HGNC: 17198
Ensembl: ENSG00000131873
Vega: OTTHUMG00000149873
Pharos: Q86X52(Tbio)
UniProt: Q86X52
Position
15q26.3
AA seq 802 aa
MAARGRRAWLSVLLGLVLGFVLASRLVLPRASELKRAGPRRRASPEGCRSGQAAASQAGG
ARGDARGAQLWPPGSDPDGGPRDRNFLFVGVMTAQKYLQTRAVAAYRTWSKTIPGKVQFF
SSEGSDTSVPIPVVPLRGVDDSYPPQKKSFMMLKYMHDHYLDKYEWFMRADDDVYIKGDR
LENFLRSLNSSEPLFLGQTGLGTTEEMGKLALEPGENFCMGGPGVIMSREVLRRMVPHIG
KCLREMYTTHEDVEVGRCVRRFAGVQCVWSYEMQQLFYENYEQNKKGYIRDLHNSKIHQA
ITLHPNKNPPYQYRLHSYMLSRKISELRHRTIQLHREIVLMSKYSNTEIHKEDLQLGIPP
SFMRFQPRQREEILEWEFLTGKYLYSAVDGQPPRRGMDSAQREALDDIVMQVMEMINANA
KTRGRIIDFKEIQYGYRRVNPMYGAEYILDLLLLYKKHKGKKMTVPVRRHAYLQQTFSKI
QFVEHEELDAQELAKRINQESGSLSFLSNSLKKLVPFQLPGSKSEHKEPKDKKINILIPL
SGRFDMFVRFMGNFEKTCLIPNQNVKLVVLLFNSDSNPDKAKQVELMRDYRIKYPKADMQ
ILPVSGEFSRALALEVGSSQFNNESLLFFCDVDLVFTTEFLQRCRANTVLGQQIYFPIIF
SQYDPKIVYSGKVPSDNHFAFTQKTGFWRNYGFGITCIYKGDLVRVGGFDVSIQGWGLED
VDLFNKVVQAGLKTFRSQEVGVVHVHHPVFCDPNLDPKQYKMCLGSKASTYGSTQQLAEM
WLEKNDPSYSKSSNNNGSVRTA
NT seq 2409 nt   +upstreamnt  +downstreamnt
atggccgcgcgcggccggcgcgcctggctcagcgtgctgctcgggctcgtcctgggcttc
gtgctggcctcgcggctcgtcctgccccgggcttccgagctgaagcgagcgggcccacgg
cgccgcgccagccccgagggctgccggtccgggcaggcggcggcttcccaggccggcggg
gcgcgcggcgatgcgcgcggggcgcagctctggccgcccggctcggacccagatggcggc
ccgcgcgacaggaactttctcttcgtgggagtcatgaccgcccagaaatacctgcagact
cgggccgtggccgcctacagaacatggtccaagacaattcctgggaaagttcagttcttc
tcaagtgagggttctgacacatctgtaccaattccagtagtgccactacggggtgtggac
gactcctacccgccccagaagaagtccttcatgatgctcaagtacatgcacgaccactac
ttggacaagtatgaatggtttatgagagcagatgatgacgtgtacatcaaaggagaccgt
ctggagaacttcctgaggagtttgaacagcagcgagcccctctttcttgggcagacaggc
ctgggcaccacggaagaaatgggaaaactggccctggagcctggtgagaacttctgcatg
ggggggcctggcgtgatcatgagccgggaggtgcttcggagaatggtgccgcacattggc
aagtgtctccgggagatgtacaccacccatgaggacgtggaggtgggaaggtgtgtccgg
aggtttgcaggggtgcagtgtgtctggtcttatgagatgcagcagcttttttatgagaat
tacgagcagaacaaaaaggggtacattagagatctccataacagtaaaattcaccaagct
atcacattacaccccaacaaaaacccaccctaccagtacaggctccacagctacatgctg
agccgcaagatatccgagctccgccatcgcacaatacagctgcaccgcgaaattgtcctg
atgagcaaatacagcaacacagaaattcataaagaggacctccagctgggaatccctccc
tccttcatgaggtttcagccccgccagcgagaggagattctggaatgggagtttctgact
ggaaaatacttgtattcggcagttgacggccagccccctcgaagaggaatggactccgcc
cagagggaagccttggacgacattgtcatgcaggtcatggagatgatcaatgccaacgcc
aagaccagagggcgcatcattgacttcaaagagatccagtacggctaccgccgggtgaac
cccatgtatggggctgagtacatcctggacctgctgcttctgtacaaaaagcacaaaggg
aagaaaatgacggtccctgtgaggaggcacgcgtatttacagcagactttcagcaaaatc
cagtttgtggagcatgaggagctggatgcacaagagttggccaagagaatcaatcaggaa
tctggatccttgtcctttctctcaaactccctgaagaagctcgtcccctttcagctccct
gggtcgaagagtgagcacaaagaacccaaagataaaaagataaacatactgattcctttg
tctgggcgtttcgacatgtttgtgagatttatgggaaactttgagaagacgtgtcttatc
cccaatcagaacgtcaagctcgtggttctgcttttcaattctgactccaaccctgacaag
gccaaacaagttgaactgatgagagattaccgcattaagtaccctaaagccgacatgcag
attttgcctgtgtctggagagttttcaagagccctggccctggaagtaggatcctcccag
tttaacaatgaatctttgctcttcttctgcgacgtcgacctcgtgtttactacagaattc
cttcagcgatgtcgagcaaatacagttctgggccaacaaatatattttccaatcatcttc
agccagtatgacccaaagattgtttatagtgggaaagttcccagtgacaaccattttgcc
tttactcagaaaactggcttctggagaaactatgggtttggcatcacgtgtatttataag
ggagatcttgtccgagtgggtggctttgatgtttccatccaaggctgggggctggaggat
gtggaccttttcaacaaggttgtccaggcaggtttgaagacgtttaggagccaggaagta
ggagtagtccacgtccaccatcctgtcttttgtgatcccaatcttgaccccaaacagtac
aaaatgtgcttggggtccaaagcatcgacctatgggtccacccagcagctggctgagatg
tggctggaaaaaaatgatccaagttacagtaaaagcagcaataataatggctcagtgagg
acagcctaa

KEGG   Homo sapiens (human): 337876
Entry
337876            CDS       T01001                                 

Gene name
CHSY3, CHSY2, CSS3
Definition
(RefSeq) chondroitin sulfate synthase 3
  KO
K13499  chondroitin sulfate synthase [EC:2.4.1.175 2.4.1.226]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
hsa01100  Metabolic pathways
Module
hsa_M00058  Glycosaminoglycan biosynthesis, chondroitin sulfate backbone
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    337876 (CHSY3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    337876 (CHSY3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.175  glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase
     337876 (CHSY3)
    2.4.1.226  N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase
     337876 (CHSY3)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   337876 (CHSY3)
SSDB
Motif
Pfam: CHGN Fringe Glyco_transf_7C Galactosyl_T Glyco_tranf_2_2 Glyco_transf_21
Other DBs
NCBI-GeneID: 337876
NCBI-ProteinID: NP_787052
OMIM: 609963
HGNC: 24293
Ensembl: ENSG00000198108
Vega: OTTHUMG00000163043
Pharos: Q70JA7(Tbio)
UniProt: Q70JA7
Position
5q23.3
AA seq 882 aa
MAVRSRRPWMSVALGLVLGFTAASWLIAPRVAELSERKRRGSSLCSYYGRSAAGPRAGAQ
QPLPQPQSRPRQEQSPPPARQDLQGPPLPEAAPGITSFRSSPWQQPPPLQQRRRGREPEG
ATGLPGAPAAEGEPEEEDGGAAGQRRDGRPGSSHNGSGDGGAAAPSARPRDFLYVGVMTA
QKYLGSRALAAQRTWARFIPGRVEFFSSQQPPNAGQPPPPLPVIALPGVDDSYPPQKKSF
MMIKYMHDHYLDKYEWFMRADDDVYIKGDKLEEFLRSLNSSKPLYLGQTGLGNIEELGKL
GLEPGENFCMGGPGMIFSREVLRRMVPHIGECLREMYTTHEDVEVGRCVRRFGGTQCVWS
YEMQQLFHENYEHNRKGYIQDLHNSKIHAAITLHPNKRPAYQYRLHNYMLSRKISELRYR
TIQLHRESALMSKLSNTEVSKEDQQLGVIPSFNHFQPRERNEVIEWEFLTGKLLYSAAEN
QPPRQSLSSILRTALDDTVLQVMEMINENAKSRGRLIDFKEIQYGYRRVNPMHGVEYILD
LLLLYKRHKGRKLTVPVRRHAYLQQLFSKPFFRETEELDVNSLVESINSETQSFSFISNS
LKILSSFQGAKEMGGHNEKKVHILVPLIGRYDIFLRFMENFENMCLIPKQNVKLVIILFS
RDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMASAQFDNDTLLLFCDVD
LIFREDFLQRCRDNTIQGQQVYYPIIFSQYDPKVTNGGNPPTDDYFIFSKKTGFWRDYGY
GITCIYKSDLLGAGGFDTSIQGWGLEDVDLYNKVILSGLRPFRSQEVGVVHIFHPVHCDP
NLDPKQYKMCLGSKASTFASTMQLAELWLEKHLGVRYNRTLS
NT seq 2649 nt   +upstreamnt  +downstreamnt
atggctgtgcgctctcgccgcccgtggatgagcgtggcattagggctggtgctgggcttc
accgccgcgtcctggctcatcgcccccagggtggcggagctgagcgagaggaagagacgt
ggctccagcctctgctcctactacggtcgctctgctgctggcccccgcgccggcgctcag
cagccgctcccccagccccagtcccgaccacggcaggagcagtcgccgccccccgcgcgc
caggatctccaggggccaccgctgcccgaggcagcacccgggatcaccagttttcgaagc
agcccctggcagcagccacctccgctgcagcagcggcggcgaggacgcgagcctgagggc
gcgacggggcttcccggtgctccagcggccgagggggagcccgaggaggaggacgggggc
gcggctgggcagcggagagacggccggccggggagtagccacaacggcagcggggacggg
ggcgctgccgccccgagcgcccgaccccgggacttcctgtacgtgggggtgatgaccgcg
cagaagtacctgggcagccgcgcgctggccgcgcagcggacctgggcgcgtttcatcccg
ggccgcgtggagttcttttccagccagcagccccccaacgccggccagcccccgccaccc
ctgcctgtcatcgcgctaccgggtgtggacgactcctatcctccccagaaaaagtccttc
atgatgatcaagtacatgcacgaccactacctggacaagtatgagtggttcatgcgcgcc
gacgacgatgtctacatcaaaggtgataaattagaagagtttcttagatcgctaaacagc
agtaagcctctctacctgggacagactggcctggggaatattgaagagcttggaaagctg
ggactggagcctggggaaaacttctgtatgggaggacctggcatgatctttagccgagaa
gttctcaggaggatggtgccacatattggtgaatgccttagagaaatgtacacgactcat
gaggatgtggaagtaggaagatgcgttcgccgttttggtgggactcagtgtgtctggtct
tacgagatgcaacaactgttccatgaaaattatgaacacaatcggaagggttacatccaa
gaccttcacaatagcaaaatccatgcagccataacacttcatcccaacaaaaggcctgca
taccaatacaggctgcataattacatgctcagccgcaaaatttctgaacttcgctaccgc
accatccagctccacagggaaagtgccctgatgagcaagctcagtaacacagaagtgagc
aaagaggaccagcagctgggagtgataccttctttcaaccacttccagcctcgggagaga
aatgaagtgatagaatgggagttcctgacagggaagcttctatactcagcagctgagaac
cagccccctcgacagagcctcagtagcattttaagaacagcactggatgataccgtccta
caggtgatggagatgatcaatgagaatgccaagagcagaggacggctcattgacttcaag
gaaattcagtatggctaccgcagagttaaccccatgcacggggtggagtacattttggat
ttactccttttatacaaaagacacaagggaaggaaactgactgtgccagtgagacgtcat
gcctatcttcagcagttgttcagcaagcctttcttcagagagaccgaagagctagatgtc
aacagtcttgtggagagtattaacagtgaaactcagtcattctcctttatatctaattct
ttaaagatattatcttcttttcaaggtgccaaagaaatgggagggcacaatgaaaagaaa
gtacacattctcgttcctctcatcggaaggtatgacattttcttgagattcatggagaac
tttgaaaacatgtgtcttatcccaaagcagaatgtaaagttggtcattatccttttcagt
agggattctggccaagactccagcaagcatattgagctgataaaagggtaccagaacaag
taccccaaagcagaaatgaccctgatcccaatgaagggagagttttccagaggtcttggt
cttgaaatggcttctgcccagtttgacaatgacactttgctgctattttgtgatgttgac
ttgatcttcagagaagattttctccaacgatgtagagacaatacaattcagggacaacag
gtgtactatcccatcatctttagccagtatgacccaaaggtaacaaacgggggaaatcct
cccactgatgattacttcatattctcaaaaaagactggattttggagagactatggatat
ggcatcacctgtatttacaaaagtgatcttctaggtgcaggtggatttgatacctcaata
caaggctggggactagaagatgtagatctctacaataaagtcattctatctggcttaagg
ccattcagaagccaagaagtaggagtggtgcatattttccatccagttcattgtgatcct
aacttggaccctaagcagtataagatgtgcttaggatccaaggcaagtactttcgcctca
accatgcaactggctgaactctggcttgaaaaacatttaggtgtcaggtacaatcgaact
ctctcctga

KEGG   Homo sapiens (human): 54480
Entry
54480             CDS       T01001                                 

Gene name
CHPF2, CSGLCA-T, CSGlcAT, ChSy-3, chPF-2
Definition
(RefSeq) chondroitin polymerizing factor 2
  KO
K03419  chondroitin polymerizing factor 2 [EC:2.4.1.226]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
hsa01100  Metabolic pathways
Module
hsa_M00058  Glycosaminoglycan biosynthesis, chondroitin sulfate backbone
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    54480 (CHPF2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    54480 (CHPF2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.226  N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase
     54480 (CHPF2)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   54480 (CHPF2)
SSDB
Motif
Pfam: CHGN Fringe
Other DBs
NCBI-GeneID: 54480
NCBI-ProteinID: NP_061888
OMIM: 608037
HGNC: 29270
Ensembl: ENSG00000033100
Vega: OTTHUMG00000157380
Pharos: Q9P2E5(Tdark)
UniProt: Q9P2E5
Position
7q36.1
AA seq 772 aa
MRLSSLLALLRPALPLILGLSLGCSLSLLRVSWIQGEGEDPCVEAVGERGGPQNPDSRAR
LDQSDEDFKPRIVPYYRDPNKPYKKVLRTRYIQTELGSRERLLVAVLTSRATLSTLAVAV
NRTVAHHFPRLLYFTGQRGARAPAGMQVVSHGDERPAWLMSETLRHLHTHFGADYDWFFI
MQDDTYVQAPRLAALAGHLSINQDLYLGRAEEFIGAGEQARYCHGGFGYLLSRSLLLRLR
PHLDGCRGDILSARPDEWLGRCLIDSLGVGCVSQHQGQQYRSFELAKNRDPEKEGSSAFL
SAFAVHPVSEGTLMYRLHKRFSALELERAYSEIEQLQAQIRNLTVLTPEGEAGLSWPVGL
PAPFTPHSRFEVLGWDYFTEQHTFSCADGAPKCPLQGASRADVGDALETALEQLNRRYQP
RLRFQKQRLLNGYRRFDPARGMEYTLDLLLECVTQRGHRRALARRVSLLRPLSRVEILPM
PYVTEATRVQLVLPLLVAEAAAAPAFLEAFAANVLEPREHALLTLLLVYGPREGGRGAPD
PFLGVKAAAAELERRYPGTRLAWLAVRAEAPSQVRLMDVVSKKHPVDTLFFLTTVWTRPG
PEVLNRCRMNAISGWQAFFPVHFQEFNPALSPQRSPPGPPGAGPDPPSPPGADPSRGAPI
GGRFDRQASAEGCFYNADYLAARARLAGELAGQEEEEALEGLEVMDVFLRFSGLHLFRAV
EPGLVQKFSLRDCSPRLSEELYHRCRLSNLEGLGGRAQLAMALFEQEQANST
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgcgactgagctccctgttggctctgctgcggccagcgcttcccctcatcttagggctg
tctctggggtgcagcctgagcctcctgcgggtttcctggatccagggggagggagaagat
ccctgtgtcgaggctgtaggggagcgaggagggccacagaatccagattccagagctcgg
ctagaccaaagtgatgaagacttcaaaccccggattgtcccctactacagggaccccaac
aagccctacaagaaggtgctcaggactcggtacatccagacagagctgggctcccgtgag
cggttgctggtggctgtcctgacctcccgagctacactgtccactttggccgtggctgtg
aaccgtacggtggcccatcacttccctcggttactctacttcactgggcagcggggggcc
cgggctccagcagggatgcaggtggtgtctcatggggatgagcggcccgcctggctcatg
tcagagaccctgcgccaccttcacacacactttggggccgactacgactggttcttcatc
atgcaggatgacacatatgtgcaggccccccgcctggcagcccttgctggccacctcagc
atcaaccaagacctgtacttaggccgggcagaggagttcattggcgcaggcgagcaggcc
cggtactgtcatgggggctttggctacctgttgtcacggagtctcctgcttcgtctgcgg
ccacatctggatggctgccgaggagacattctcagtgcccgtcctgacgagtggcttgga
cgctgcctcattgactctctgggcgtcggctgtgtctcacagcaccaggggcagcagtat
cgctcatttgaactggccaaaaatagggaccctgagaaggaagggagctcggctttcctg
agtgccttcgccgtgcaccctgtctccgaaggtaccctcatgtaccggctccacaaacgc
ttcagcgctctggagttggagcgggcttacagtgaaatagaacaactgcaggctcagatc
cggaacctgaccgtgctgacccccgaaggggaggcagggctgagctggcccgttgggctc
cctgctcctttcacaccacactctcgctttgaggtgctgggctgggactacttcacagag
cagcacaccttctcctgtgcagatggggctcccaagtgcccactacagggggctagcagg
gcggacgtgggtgatgcgttggagactgccctggagcagctcaatcggcgctatcagccc
cgcctgcgcttccagaagcagcgactgctcaacggctatcggcgcttcgacccagcacgg
ggcatggagtacaccctggacctgctgttggaatgtgtgacacagcgtgggcaccggcgg
gccctggctcgcagggtcagcctgctgcggccactgagccgggtggaaatcctacctatg
ccctatgtcactgaggccacccgagtgcagctggtgctgccactcctggtggctgaagct
gctgcagccccggctttcctcgaggcctttgcagccaatgtcctggagccacgagaacat
gcattgctcaccctgttgctggtctacgggccacgagaaggtggccgtggagctccagac
ccatttcttggggtgaaggctgcagcagcggagttagagcgacggtaccctgggacgagg
ctggcctggctcgctgtgcgagcagaggccccttcccaggtgcgactcatggacgtggtc
tcgaagaagcaccctgtggacactctcttcttccttaccaccgtgtggacaaggcctggg
cccgaagtcctcaaccgctgtcgcatgaatgccatctctggctggcaggccttctttcca
gtccatttccaggagttcaatcctgccctgtcaccacagagatcacccccagggcccccg
ggggctggccctgaccccccctcccctcctggtgctgacccctcccggggggctcctata
ggggggagatttgaccggcaggcttctgcggagggctgcttctacaacgctgactacctg
gcggcccgagcccggctggcaggtgaactggcaggccaggaagaggaggaagccctggag
gggctggaggtgatggatgttttcctccggttctcagggctccacctctttcgggccgta
gagccagggctggtgcagaagttctccctgcgagactgcagcccacggctcagtgaagaa
ctctaccaccgctgccgcctcagcaacctggaggggctagggggccgtgcccagctggct
atggctctctttgagcaggagcaggccaatagcacttag

KEGG   Homo sapiens (human): 55454
Entry
55454             CDS       T01001                                 

Gene name
CSGALNACT2, CHGN2, ChGn-2, GALNACT-2, GALNACT2, PRO0082, beta4GalNAcT
Definition
(RefSeq) chondroitin sulfate N-acetylgalactosaminyltransferase 2
  KO
K00746  chondroitin sulfate N-acetylgalactosaminyltransferase 1/2 [EC:2.4.1.174 2.4.1.175]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
hsa01100  Metabolic pathways
Module
hsa_M00058  Glycosaminoglycan biosynthesis, chondroitin sulfate backbone
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    55454 (CSGALNACT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    55454 (CSGALNACT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.174  glucuronylgalactosylproteoglycan 4-beta-N-acetylgalactosaminyltransferase
     55454 (CSGALNACT2)
    2.4.1.175  glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase
     55454 (CSGALNACT2)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   55454 (CSGALNACT2)
SSDB
Motif
Pfam: CHGN Glyco_transf_7C Glyco_tranf_2_2 KfrA_N SlyX Csm1_N Uso1_p115_C
Other DBs
NCBI-GeneID: 55454
NCBI-ProteinID: NP_061060
OMIM: 616616
HGNC: 24292
Ensembl: ENSG00000169826
Vega: OTTHUMG00000018023
Pharos: Q8N6G5(Tbio)
UniProt: Q8N6G5 A0A0S2Z5F5
Position
10q11.21
AA seq 542 aa
MPRRGLILHTRTHWLLLGLALLCSLVLFMYLLECAPQTDGNASLPGVVGENYGKEYYQAL
LQEQEEHYQTRATSLKRQIAQLKQELQEMSEKMRSLQERRNVGANGIGYQSNKEQAPSDL
LEFLHSQIDKAEVSIGAKLPSEYGVIPFESFTLMKVFQLEMGLTRHPEEKPVRKDKRDEL
VEVIEAGLEVINNPDEDDEQEDEEGPLGEKLIFNENDFVEGYYRTERDKGTQYELFFKKA
DLTEYRHVTLFRPFGPLMKVKSEMIDITRSIINIIVPLAERTEAFVQFMQNFRDVCIHQD
KKIHLTVVYFGKEGLSKVKSILESVTSESNFHNYTLVSLNEEFNRGRGLNVGARAWDKGE
VLMFFCDVDIYFSAEFLNSCRLNAEPGKKVFYPVVFSLYNPAIVYANQEVPPPVEQQLVH
KKDSGFWRDFGFGMTCQYRSDFLTIGGFDMEVKGWGGEDVHLYRKYLHGDLIVIRTPVPG
LFHLWHEKRCADELTPEQYRMCIQSKAMNEASHSHLGMLVFREEIETHLHKQAYRTNSEA
VG
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgcctagaagaggactgattcttcacacccggacccactggttgctgttgggccttgct
ttgctctgcagtttggtattatttatgtacctcctggaatgtgccccccagactgatgga
aatgcatctcttcctggtgttgttggggaaaattatggtaaagagtattatcaagccctc
ctacaggaacaagaagaacattatcagaccagggcaaccagtctgaaacgccaaattgcc
caactaaaacaagaattacaagaaatgagtgagaagatgcggtcactgcaagaaagaagg
aatgtaggggctaatggcataggctatcagagcaacaaagagcaagcacctagtgatctt
ttagagtttcttcattcccaaattgacaaagctgaagttagcataggggccaaactaccc
agtgagtatggggtcattccctttgaaagttttaccttaatgaaagtatttcaattggaa
atgggtctcactcgccatcctgaagaaaagccagttagaaaagacaaacgagatgaattg
gtggaagttattgaagcgggcttggaggtcattaataatcctgatgaagatgatgaacaa
gaagatgaggagggtccccttggagagaaactgatatttaatgaaaatgacttcgtagaa
ggttattatcgcactgagagagataagggcacacagtatgaactcttttttaagaaagca
gaccttacggaatatagacatgtgaccctcttccgcccttttggacctctcatgaaagtg
aagagtgagatgattgacatcactagatcaattattaatatcattgtgccacttgctgaa
agaactgaagcatttgtacaatttatgcagaacttcagggatgtttgtattcatcaagac
aagaagattcatctcacagtggtgtattttggtaaagaaggactgtctaaagtcaagtct
atcctagaatctgtcaccagtgagtctaattttcacaattacaccttggtctcattgaat
gaagaatttaatcgtggacgaggactaaatgtgggtgcccgagcttgggacaagggagag
gtcttgatgtttttctgtgatgttgatatctatttctcagccgaattccttaacagctgc
cggttaaatgctgagccaggtaagaaggtgttttaccctgtggtgttcagtctttacaat
cctgccattgtttatgccaaccaggaagtgccaccacctgtggagcagcagctggttcac
aaaaaggattctggcttttggcgagattttggctttggaatgacttgtcagtatcgttca
gatttcctgaccattggtggatttgacatggaagtgaaaggttggggtggagaagatgtt
catctttatcgaaaatacttacatggtgacctcattgtgattcggactccggttcctggt
cttttccacctctggcatgaaaagcgctgtgctgatgagctgacccccgagcagtaccgc
atgtgcatccagtctaaagccatgaatgaggcctctcactcccacctgggaatgctggtc
ttcagggaggaaatagagacgcatcttcataaacaggcatacaggacaaacagtgaagct
gttggttga

KEGG   Homo sapiens (human): 55790
Entry
55790             CDS       T01001                                 

Gene name
CSGALNACT1, CSGalNAcT-1, ChGn, ChGn-1, SDJLABA, beta4GalNAcT
Definition
(RefSeq) chondroitin sulfate N-acetylgalactosaminyltransferase 1
  KO
K00746  chondroitin sulfate N-acetylgalactosaminyltransferase 1/2 [EC:2.4.1.174 2.4.1.175]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
hsa01100  Metabolic pathways
Module
hsa_M00058  Glycosaminoglycan biosynthesis, chondroitin sulfate backbone
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    55790 (CSGALNACT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    55790 (CSGALNACT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.174  glucuronylgalactosylproteoglycan 4-beta-N-acetylgalactosaminyltransferase
     55790 (CSGALNACT1)
    2.4.1.175  glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase
     55790 (CSGALNACT1)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   55790 (CSGALNACT1)
SSDB
Motif
Pfam: CHGN Glyco_transf_7C Phage_Mu_Gam DUF4618
Other DBs
NCBI-GeneID: 55790
NCBI-ProteinID: NP_001123990
OMIM: 616615
HGNC: 24290
Ensembl: ENSG00000147408
Vega: OTTHUMG00000130827
Pharos: Q8TDX6(Tbio)
UniProt: Q8TDX6
Position
8p21.3
AA seq 532 aa
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAV
LQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADL
LAFLHSQVDKAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDEL
VEAIESALETLNSPAENSPNHRPYTASDFIEGIYRTERDKGTLYELTFKGDHKHEFKRLI
LFRPFGPIMKVKNEKLNMANTLINVIVPLAKRVDKFRQFMQNFREMCIEQDGRVHLTVVY
FGKEEINEVKGILENTSKAANFRNFTFIQLNGEFSRGKGLDVGARFWKGSNVLLFFCDVD
IYFTSEFLNTCRLNTQPGKKVFYPVLFSQYNPGIIYGHHDAVPPLEQQLVIKKETGFWRD
FGFGMTCQYRSDFINIGGFDLDIKGWGGEDVHLYRKYLHSNLIVVRTPVRGLFHLWHEKR
CMDELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgatgatggttcgccgggggctgcttgcgtggatttcccgggtggtggttttgctggtg
ctcctctgctgtgctatctctgtcctgtacatgttggcctgcaccccaaaaggtgacgag
gagcagctggcactgcccagggccaacagccccacggggaaggaggggtaccaggccgtc
cttcaggagtgggaggagcagcaccgcaactacgtgagcagcctgaagcggcagatcgca
cagctcaaggaggagctgcaggagaggagtgagcagctcaggaatgggcagtaccaagcc
agcgatgctgctggcctgggtctggacaggagccccccagagaaaacccaggccgacctc
ctggccttcctgcactcgcaggtggacaaggcagaggtgaatgctggcgtcaagctggcc
acagagtatgcagcagtgcctttcgatagctttactctacagaaggtgtaccagctggag
actggccttacccgccaccccgaggagaagcctgtgaggaaggacaagcgggatgagttg
gtggaagccattgaatcagccttggagaccctgaacagtcctgcagagaacagccccaat
caccgtccttacacggcctctgatttcatagaagggatctaccgaacagaaagggacaaa
gggacattgtatgagctcaccttcaaaggggaccacaaacacgaattcaaacggctcatc
ttatttcgaccattcggccccatcatgaaagtgaaaaatgaaaagctcaacatggccaac
acgcttatcaatgttatcgtgcctctagcaaaaagggtggacaagttccggcagttcatg
cagaatttcagggagatgtgcattgagcaggatgggagagtccatctcactgttgtttac
tttgggaaagaagaaataaatgaagtcaaaggaatacttgaaaacacttccaaagctgcc
aacttcaggaactttaccttcatccagctgaatggagaattttctcggggaaagggactt
gatgttggagcccgcttctggaagggaagcaacgtccttctctttttctgtgatgtggac
atctacttcacatctgaattcctcaatacgtgtaggctgaatacacagccagggaagaag
gtattttatccagttcttttcagtcagtacaatcctggcataatatacggccaccatgat
gcagtccctcccttggaacagcagctggtcataaagaaggaaactggattttggagagac
tttggatttgggatgacgtgtcagtatcggtcagacttcatcaatataggtgggtttgat
ctggacatcaaaggctggggcggagaggatgtgcacctttatcgcaagtatctccacagc
aacctcatagtggtacggacgcctgtgcgaggactcttccacctctggcatgagaagcgc
tgcatggacgagctgacccccgagcagtacaagatgtgcatgcagtccaaggccatgaac
gaggcatcccacggccagctgggcatgctggtgttcaggcacgagatagaggctcacctt
cgcaaacagaaacagaagacaagtagcaaaaaaacatga

KEGG   Homo sapiens (human): 79586
Entry
79586             CDS       T01001                                 

Gene name
CHPF, CHSY2, CSS2
Definition
(RefSeq) chondroitin polymerizing factor
  KO
K00747  chondroitin polymerizing factor [EC:2.4.1.175 2.4.1.226]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
hsa01100  Metabolic pathways
Module
hsa_M00058  Glycosaminoglycan biosynthesis, chondroitin sulfate backbone
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    79586 (CHPF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    79586 (CHPF)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.175  glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase
     79586 (CHPF)
    2.4.1.226  N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase
     79586 (CHPF)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   79586 (CHPF)
SSDB
Motif
Pfam: CHGN Fringe
Other DBs
NCBI-GeneID: 79586
NCBI-ProteinID: NP_078812
OMIM: 610405
HGNC: 24291
Ensembl: ENSG00000123989
Vega: OTTHUMG00000058929
Pharos: Q8IZ52(Tbio)
UniProt: Q8IZ52
Position
2q35
AA seq 775 aa
MRASLLLSVLRPAGPVAVGISLGFTLSLLSVTWVEEPCGPGPPQPGDSELPPRGNTNAAR
RPNSVQPGAEREKPGAGEGAGENWEPRVLPYHPAQPGQAAKKAVRTRYISTELGIRQRLL
VAVLTSQTTLPTLGVAVNRTLGHRLERVVFLTGARGRRAPPGMAVVTLGEERPIGHLHLA
LRHLLEQHGDDFDWFFLVPDTTYTEAHGLARLTGHLSLASAAHLYLGRPQDFIGGEPTPG
RYCHGGFGVLLSRMLLQQLRPHLEGCRNDIVSARPDEWLGRCILDATGVGCTGDHEGVHY
SHLELSPGEPVQEGDPHFRSALTAHPVRDPVHMYQLHKAFARAELERTYQEIQELQWEIQ
NTSHLAVDGDQAAAWPVGIPAPSRPASRFEVLRWDYFTEQHAFSCADGSPRCPLRGADRA
DVADVLGTALEELNRRYHPALRLQKQQLVNGYRRFDPARGMEYTLDLQLEALTPQGGRRP
LTRRVQLLRPLSRVEILPVPYVTEASRLTVLLPLAAAERDLAPGFLEAFATAALEPGDAA
AALTLLLLYEPRQAQRVAHADVFAPVKAHVAELERRFPGARVPWLSVQTAAPSPLRLMDL
LSKKHPLDTLFLLAGPDTVLTPDFLNRCRMHAISGWQAFFPMHFQAFHPAVAPPQGPGPP
ELGRDTGRFDRQAASEACFYNSDYVAARGRLAAASEQEEELLESLDVYELFLHFSSLHVL
RAVEPALLQRYRAQTCSARLSEDLYHRCLQSVLEGLGSRTQLAMLLFEQEQGNST
NT seq 2328 nt   +upstreamnt  +downstreamnt
atgcgggcatcgctgctgctgtcggtgctgcggcccgcagggcccgtggccgtgggcatc
tccctgggcttcaccctgagcctgctcagcgtcacctgggtggaggagccgtgcggccca
ggcccgccccaacctggagactctgagctgccgccgcgcggcaacaccaacgcggcgcgc
cggcccaactcggtgcagcccggagcggagcgcgagaagcccggggccggcgaaggcgcc
ggggagaattgggagccgcgcgtcttgccctaccaccctgcacagcccggccaggccgcc
aaaaaggccgtcaggacccgctacatcagcacggagctgggcatcaggcagaggctgctg
gtggcggtgctgacctctcagaccacgctgcccacgctgggcgtggccgtgaaccgcacg
ctggggcaccggctggagcgtgtggtgttcctgacgggcgcacggggccgccgggcccca
cctggcatggcagtggtgacgctaggcgaggagcgacccattggacacctgcacctggcg
ctgcgccacctgctggagcagcacggcgacgactttgactggttcttcctggtgcctgac
accacctacaccgaggcgcacggcctggcacgcctaactggccacctcagcctggcctcc
gccgcccacctgtacctgggccggccccaggacttcatcggcggagagcccacccccggc
cgctactgccacggaggctttggggtgctgctgtcgcgcatgctgctgcaacaactgcgc
ccccacctggaaggctgccgcaacgacatcgtcagtgcgcgccctgacgagtggctgggt
cgctgcattctcgatgccaccggggtgggctgcactggtgaccacgagggggtgcactat
agccatctggagctgagccctggggagccagtgcaggagggggaccctcatttccgaagt
gccctgacagcccaccctgtgcgtgaccctgtgcacatgtaccagctgcacaaagctttc
gcccgagctgaactggaacgcacgtaccaggagatccaggagttacagtgggagatccag
aataccagccatctggccgttgatggggaccaggcagctgcttggcccgtgggtattcca
gcaccatcccgcccggcctcccgctttgaggtgctgcgctgggactacttcacggagcag
cacgctttctcctgcgccgatggctcaccccgctgcccactgcgtggggctgaccgggct
gatgtggccgatgttctggggacagctctagaggagctgaaccgccgctaccacccggcc
ttgcggctccagaagcagcagctggtgaatggctaccgacgctttgatccggcccggggt
atggaatacacgctggacttgcagctggaggcactgaccccccagggaggccgccggccc
ctcactcgccgagtgcagctgctccggccgctgagccgcgtggagatcttgcctgtgccc
tatgtcactgaggcctcacgtctcactgtgctgctgcctctagctgcggctgagcgtgac
ctggcccctggcttcttggaggcctttgccactgcagcactggagcctggtgatgctgcg
gcagccctgaccctgctgctactgtatgagccgcgccaggcccagcgcgtggcccatgca
gatgtcttcgcacctgtcaaggcccacgtggcagagctggagcggcgtttccccggtgcc
cgggtgccatggctcagtgtgcagacagccgcaccctcaccactgcgcctcatggatcta
ctctccaagaagcacccgctggacacactgttcctgctggccgggccagacacggtgctc
acgcctgacttcctgaaccgctgccgcatgcatgccatctccggctggcaggccttcttt
cccatgcatttccaagccttccacccagctgtggccccaccacaagggcctgggccccca
gagctgggccgtgacactggccgctttgatcgccaggcagccagcgaggcctgcttctac
aactccgactatgtggcagcccgtgggcgcctggcggcagcctcagaacaagaagaggag
ctgctggagagcctggatgtgtacgagctgttcctccacttctccagtctgcatgtgctg
cgggcggtggagccggcgctgctgcagcgctaccgggcccagacgtgcagcgcgaggctc
agtgaggacctgtaccaccgctgcctccagagcgtgcttgagggcctcggctcccgaacc
cagctggccatgctactctttgaacaggagcagggcaacagcacctga

DBGET integrated database retrieval system