KEGG   Homo sapiens (human): 22863
Entry
22863             CDS       T01001                                 

Gene name
ATG14, ATG14L, BARKOR, KIAA0831
Definition
(RefSeq) autophagy related 14
  KO
K17889  beclin 1-associated autophagy-related key regulator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05131  Shigellosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06128  Autophagy (viruses and bacteria)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
nt06413  Autophagy
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
  Element
N00155  Autophagy-vesicle nucleation
N00177  KSHV vBCL2 to autophagy-vesicle nucleation
N00962  Mutation-inactivated ATXN3 to autophagy-vesicle nucleation
N00993  Mutation-caused aberrant Htt to autophagy-vesicle nucleation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    22863 (ATG14)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    22863 (ATG14)
   05014 Amyotrophic lateral sclerosis
    22863 (ATG14)
   05016 Huntington disease
    22863 (ATG14)
   05017 Spinocerebellar ataxia
    22863 (ATG14)
   05022 Pathways of neurodegeneration - multiple diseases
    22863 (ATG14)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    22863 (ATG14)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    22863 (ATG14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    22863 (ATG14)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    22863 (ATG14)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    22863 (ATG14)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    22863 (ATG14)
SSDB
Motif
Pfam: Atg14 MnmE_helical Exonuc_VII_L HsdM_N
Other DBs
NCBI-GeneID: 22863
NCBI-ProteinID: NP_055739
OMIM: 613515
HGNC: 19962
Ensembl: ENSG00000126775
Vega: OTTHUMG00000172129
Pharos: Q6ZNE5(Tbio)
UniProt: Q6ZNE5
Position
14q22.3
AA seq 492 aa
MASPSGKGARALEAPGCGPRPLARDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQ
SGDFVYFDGRDRERFIDKKERLSRLKSKQEEFQKEVLKAMEGKWITDQLRWKIMSCKMRI
EQLKQTICKGNEEMEKNSEGLLKTKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKT
IDLRSHYERLANLRRSHILELTSVIFPIEEVKTGVRDPADVSSESDSAMTSSTVSKLAEA
RRTTYLSGRWVCDDHNGDTSISITGPWISLPNNGDYSAYYSWVEEKKTTQGPDMEQSNPA
YTISAALCYATQLVNILSHILDVNLPKKLCNSEFCGENLSKQKFTRAVKKLNANILYLCF
SQHVNLDQLQPLHTLRNLMYLVSPSSEHLGRSGPFEVRADLEESMEFVDPGVAGESDESG
DERVSDEETDLGTDWENLPSPRFCDIPSQSVEVSQSQSTQASPPIASSSAGGMISSAAAS
VTSWFKAYTGHR
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggcgtctcccagtgggaagggagcccgggcgctggaggctcctggctgcgggccccgg
ccgctcgcccgggacctggtggactccgtggacgatgcggaggggctgtacgtggctgtg
gagcgctgcccgctgtgcaacactacccgccggcggctgacctgcgccaaatgcgttcag
agcggcgatttcgtctacttcgacggccgcgaccgggagaggtttatcgacaagaaggaa
aggttaagccgacttaagagcaagcaagaagaatttcagaaagaagtgttaaaagctatg
gaaggaaaatggataacagatcagttgagatggaaaataatgtcctgcaagatgaggatt
gaacagttaaaacaaacaatatgtaaaggaaatgaagaaatggagaaaaattctgaaggc
cttctcaaaaccaaggaaaagaatcagaagctttacagtcgagcacaacggcaccaagag
aaaaaggagaagattcagaggcataatcgcaaacttggtgacctggtagaaaaaaagacc
attgacttaagaagtcattatgagcgtctggcaaatcttcgacgatcccatatattagag
ctcacctctgtcatttttccaatcgaggaagtaaagacgggtgtgagagaccccgcagat
gtgtcttcagagagtgacagtgccatgacctccagcactgtgagcaagcttgctgaagcc
cggaggacaacttacctctcaggacgatgggtctgtgacgatcacaacggagacaccagc
attagcattacagggccttggattagcctccctaacaatggggactactctgcctactac
agctgggtggaggagaagaaaacaacccaggggcctgacatggagcagagtaaccctgcc
tacaccatcagtgctgcgctgtgctatgcaactcagctggtcaacattctgtctcatata
cttgatgtaaatcttcccaaaaagctctgcaacagtgaattttgtggcgaaaatctaagc
aagcagaaatttactcgagcagtgaagaaactgaatgcaaatattctttacctttgtttt
tctcagcatgtaaatttagatcaattacaaccactgcataccctcaggaatctaatgtac
ctggtcagtccaagctctgaacacctaggcaggtcagggccctttgaagtacgagcagac
cttgaggagtccatggaatttgtggatcccggagttgctggagaatcagatgagagcgga
gatgagcgcgtcagcgatgaagaaaccgacctgggcacagactgggagaacttgcctagt
ccccggttttgtgatatcccttcccagtctgtggaagtctcccagagtcagagcacccag
gcgtccccacccatcgcgagcagcagtgcaggtgggatgatctcctctgcagcagcctcg
gtgacctcctggtttaaagcttacactggacaccgttaa

DBGET integrated database retrieval system