KEGG   Homo sapiens (human): 22863Help
Entry
22863             CDS       T01001                                 

Gene name
ATG14, ATG14L, BARKOR, KIAA0831
Definition
(RefSeq) autophagy related 14
  KO
K17889  beclin 1-associated autophagy-related key regulator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06128  Autophagy (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
  Element
N00155  Autophagy-vesicle nucleation
N00177  KSHV vBCL2 to autophagy-vesicle nucleation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    22863 (ATG14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    22863 (ATG14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    22863 (ATG14)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    22863 (ATG14)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    22863 (ATG14)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    22863 (ATG14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Atg14 Exonuc_VII_L HsdM_N
Motif
Other DBs
NCBI-GeneID: 22863
NCBI-ProteinID: NP_055739
OMIM: 613515
HGNC: 19962
Ensembl: ENSG00000126775
Vega: OTTHUMG00000172129
Pharos: Q6ZNE5(Tbio)
UniProt: Q6ZNE5
Position
14q22.3
AA seq 492 aa AA seqDB search
MASPSGKGARALEAPGCGPRPLARDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQ
SGDFVYFDGRDRERFIDKKERLSRLKSKQEEFQKEVLKAMEGKWITDQLRWKIMSCKMRI
EQLKQTICKGNEEMEKNSEGLLKTKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKT
IDLRSHYERLANLRRSHILELTSVIFPIEEVKTGVRDPADVSSESDSAMTSSTVSKLAEA
RRTTYLSGRWVCDDHNGDTSISITGPWISLPNNGDYSAYYSWVEEKKTTQGPDMEQSNPA
YTISAALCYATQLVNILSHILDVNLPKKLCNSEFCGENLSKQKFTRAVKKLNANILYLCF
SQHVNLDQLQPLHTLRNLMYLVSPSSEHLGRSGPFEVRADLEESMEFVDPGVAGESDESG
DERVSDEETDLGTDWENLPSPRFCDIPSQSVEVSQSQSTQASPPIASSSAGGMISSAAAS
VTSWFKAYTGHR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcccagtgggaagggagcccgggcgctggaggctcctggctgcgggccccgg
ccgctcgcccgggacctggtggactccgtggacgatgcggaggggctgtacgtggctgtg
gagcgctgcccgctgtgcaacactacccgccggcggctgacctgcgccaaatgcgttcag
agcggcgatttcgtctacttcgacggccgcgaccgggagaggtttatcgacaagaaggaa
aggttaagccgacttaagagcaagcaagaagaatttcagaaagaagtgttaaaagctatg
gaaggaaaatggataacagatcagttgagatggaaaataatgtcctgcaagatgaggatt
gaacagttaaaacaaacaatatgtaaaggaaatgaagaaatggagaaaaattctgaaggc
cttctcaaaaccaaggaaaagaatcagaagctttacagtcgagcacaacggcaccaagag
aaaaaggagaagattcagaggcataatcgcaaacttggtgacctggtagaaaaaaagacc
attgacttaagaagtcattatgagcgtctggcaaatcttcgacgatcccatatattagag
ctcacctctgtcatttttccaatcgaggaagtaaagacgggtgtgagagaccccgcagat
gtgtcttcagagagtgacagtgccatgacctccagcactgtgagcaagcttgctgaagcc
cggaggacaacttacctctcaggacgatgggtctgtgacgatcacaacggagacaccagc
attagcattacagggccttggattagcctccctaacaatggggactactctgcctactac
agctgggtggaggagaagaaaacaacccaggggcctgacatggagcagagtaaccctgcc
tacaccatcagtgctgcgctgtgctatgcaactcagctggtcaacattctgtctcatata
cttgatgtaaatcttcccaaaaagctctgcaacagtgaattttgtggcgaaaatctaagc
aagcagaaatttactcgagcagtgaagaaactgaatgcaaatattctttacctttgtttt
tctcagcatgtaaatttagatcaattacaaccactgcataccctcaggaatctaatgtac
ctggtcagtccaagctctgaacacctaggcaggtcagggccctttgaagtacgagcagac
cttgaggagtccatggaatttgtggatcccggagttgctggagaatcagatgagagcgga
gatgagcgcgtcagcgatgaagaaaccgacctgggcacagactgggagaacttgcctagt
ccccggttttgtgatatcccttcccagtctgtggaagtctcccagagtcagagcacccag
gcgtccccacccatcgcgagcagcagtgcaggtgggatgatctcctctgcagcagcctcg
gtgacctcctggtttaaagcttacactggacaccgttaa

DBGET integrated database retrieval system