KEGG   Homo sapiens (human): 22869Help
Entry
22869             CDS       T01001                                 

Gene name
ZNF510
Definition
(RefSeq) zinc finger protein 510
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    22869 (ZNF510)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    22869 (ZNF510)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 ADK_lid DUF3268 zf-AN1 C1_4 zf-H2C2_5
Motif
Other DBs
NCBI-GeneID: 22869
NCBI-ProteinID: NP_001300988
HGNC: 29161
Ensembl: ENSG00000081386
Vega: OTTHUMG00000020303
Pharos: Q9Y2H8(Tdark)
UniProt: Q9Y2H8 Q6NUI8
Position
9q22.33
AA seq 683 aa AA seqDB search
MSPHPEAITDCVTLNTVGQLAEGGYPLRFSTLFQEQQKMNISQASVSFKDVTIEFTQEEW
QQMAPVQKNLYRDVMLENYSNLVSVGYCCFKPEVIFKLEQGEEPWFSEEEFSNQSHPKDY
RGDDLIKQNKKIKDKHLEQAICINNKTLTTEEEKVLGKPFTLHVAAVASTKMSCKCNSWE
VNLQSISEFIINNRNYSTKKIGCGNVCENSPFKINFEKTQTGEKFYEHNKNMKALNYNEN
LPKHPKFQTLEQAFECNKIGKAFNDKANCVKHNSSHTGETSSKDDEFRKNCDKKTLFDHR
RTGTGKKHLHLNQCGKSFEKSTVEEYNKLNMGIKHYELNPSGNNFNRKAHLTDPQTAVIE
ENPLVSNDRTQTWVKSSEYHENKKSYQTSVHRVRRRSHSMMKPYKCNECGKSFCQKGHLI
QHQRTHTGEKPFECSECGKTFSQKSHLSTHQRIHTAEKPYKCNECGKTFVQKSTLRGHQR
IHTGEKPYECSECGKTFVQKSTLRDHHRIHTGEKSFQCNQCGKTFGQKSNLRIHQRTHTG
EKTYQCNECEKSFWRKDHLIQHQKTHTGEKPFKCNECGKTFARTSTLRVHQRIHTGEKPF
KCNECGKKFVRKAILSDHQRIHTGEKPFQCNKCGKTFGQKSNLRIHQRTHSGEKSYECNE
YGKLCKKSTLSLYQKIQGEGNPY
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccacatccagaagccatcacagattgtgtgacactgaacactgtgggccaactt
gcagaaggtggttatcctttacggttctccacactctttcaggagcagcagaaaatgaac
atatctcaggcatcagtgtcattcaaggacgtgactatagaattcacccaggaggagtgg
cagcaaatggcccctgttcagaagaatctgtacagagatgtgatgctggagaactacagc
aacctcgtctcagtggggtactgctgtttcaaaccagaggtgatcttcaagttggagcaa
ggagaggagccttggttctcagaggaggaattctcaaaccagagtcacccaaaagattac
agaggtgatgacctgatcaagcagaacaagaaaatcaaagacaaacacttggagcaagca
atatgtatcaataataaaacattgactacagaggaagagaaagttttggggaaaccattt
actctgcatgtagctgctgttgcttcaacaaaaatgtcctgcaaatgcaactcatgggaa
gtgaatttgcaaagtatttctgaatttatcattaataatagaaactattcaacaaagaaa
ataggttgcggtaatgtatgtgagaattcacctttcaaaattaactttgagaaaactcag
actggagagaaattttatgaacataataaaaacatgaaagctctcaattataatgaaaat
cttcccaagcatccaaagtttcaaactttggagcaagcttttgaatgtaataaaattgga
aaagcctttaatgataaggctaactgtgttaaacataacagttctcacacaggagaaaca
tcctctaaagatgatgaatttaggaaaaattgtgataagaaaactctctttgaccacagg
agaactggcacagggaagaaacacctgcatcttaatcaatgtgggaaatcctttgagaag
tcaactgtggaggaatataataaacttaatatgggtataaaacattatgaattaaatcca
agtggaaataatttcaacagaaaggcacacctcactgatcctcaaacagctgtcatagaa
gagaacccattggtaagtaatgacagaacacagacttgggttaaatcctctgaatatcat
gaaaataagaaatcctaccagacgtcggttcacagagttcgccgaagaagtcactcaatg
atgaaaccctataaatgtaatgaatgtgggaaatccttctgtcagaaaggacatctcatt
caacatcagagaactcacacaggagagaaaccatttgaatgtagtgaatgtggaaaaact
ttctcccagaagtcacacctcagtactcatcagagaattcatacagcagaaaaaccctat
aaatgtaatgaatgtggaaaaacatttgtccagaagtcaaccctcaggggacatcaaaga
attcacacaggagaaaaaccctatgaatgtagtgaatgtgggaaaacttttgttcagaag
tccaccctcagagatcatcacagaattcacacaggggagaaatcctttcaatgcaatcaa
tgtggaaaaacatttggccagaagtcaaacctcagaatacatcagagaactcacactggg
gagaaaacttaccagtgtaatgaatgtgaaaaatccttctggcgaaaagatcatctcatt
caacatcagaaaactcacacgggagagaaaccattcaaatgtaacgaatgtgggaaaact
tttgcccggacatcaaccctcagagtgcatcaaagaattcacactggggagaaaccattt
aaatgtaatgaatgtgggaagaaatttgtccggaaagcaatccttagtgatcatcagaga
attcacacaggggagaaaccctttcagtgtaataaatgtgggaaaacttttggccagaaa
tcaaacctcagaatacatcaaaggactcacagtggggagaaatcttatgaatgcaatgaa
tatgggaaattatgtaagaagtctaccctaagcttataccagaaaattcagggagagggg
aatccctattga

DBGET integrated database retrieval system