KEGG   Homo sapiens (human): 2287Help
Entry
2287              CDS       T01001                                 

Gene name
FKBP3, FKBP-25, FKBP-3, FKBP25, PPIase
Definition
(RefSeq) FKBP prolyl isomerase 3
  KO
K09570  FK506-binding protein 3 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    2287 (FKBP3)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     2287 (FKBP3)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    2287 (FKBP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTHB FKBP_C
Motif
Other DBs
NCBI-GeneID: 2287
NCBI-ProteinID: NP_002004
OMIM: 186947
HGNC: 3719
Ensembl: ENSG00000100442
Vega: OTTHUMG00000140267
Pharos: Q00688(Tbio)
UniProt: Q00688
Structure
PDB: 

Position
14q21.2
AA seq 224 aa AA seqDB search
MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLV
TAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGD
KTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALL
TMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgttccacagcgggcgtggaccgtggagcagctgcgcagtgagcagctg
cccaagaaggacattatcaagtttctgcaggaacacggttcagattcgtttcttgcagaa
cataaattattaggaaacattaaaaatgtggccaagacagctaacaaggaccacttggtt
acagcctataaccatctttttgaaactaagcgttttaagggtactgaaagtataagtaaa
gtgtctgagcaagtaaaaaatgtgaagcttaatgaagataaacccaaagaaaccaagtct
gaagagaccctggatgagggtccaccaaaatatactaaatctgttctgaaaaagggagat
aaaaccaactttcccaaaaagggagatgttgttcactgctggtatacaggaacactacaa
gatgggactgtttttgatactaatattcaaacaagtgcaaagaagaagaaaaatgccaag
cctttaagttttaaggtcggagtaggcaaagttatcagaggatgggatgaagctctcttg
actatgagtaaaggagaaaaggctcgactggagattgaaccagaatgggcttacggaaag
aaaggacagcctgatgccaaaattccaccaaatgcaaaactcacttttgaagtggaatta
gtggatattgattga

DBGET integrated database retrieval system