KEGG   Homo sapiens (human): 22871Help
Entry
22871             CDS       T01001                                 

Gene name
NLGN1, NL1
Definition
(RefSeq) neuroligin 1
  KO
K07378  neuroligin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    22871 (NLGN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    22871 (NLGN1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    22871 (NLGN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Sarcoglycan_2
Motif
Other DBs
NCBI-GeneID: 22871
NCBI-ProteinID: NP_055747
OMIM: 600568
HGNC: 14291
Ensembl: ENSG00000169760
Vega: OTTHUMG00000157005
Pharos: Q8N2Q7(Tbio)
UniProt: Q8N2Q7
Structure
PDB: 

Position
3q26.31
AA seq 823 aa AA seqDB search
MALPRCTWPNYVWRAVMACLVHRGLGAPLTLCMLGCLLQAGHVLSQKLDDVDPLVATNFG
KIRGIKKELNNEILGPVIQFLGVPYAAPPTGERRFQPPEPPSPWSDIRNATQFAPVCPQN
IIDGRLPEVMLPVWFTNNLDVVSSYVQDQSEDCLYLNIYVPTEDDIRDSGGPKPVMVYIH
GGSYMEGTGNLYDGSVLASYGNVIVITVNYRLGVLGFLSTGDQAAKGNYGLLDLIQALRW
TSENIGFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEGNRWSNSTKGLFQRAIAQSGTAL
SSWAVSFQPAKYARMLATKVGCNVSDTVELVECLQKKPYKELVDQDIQPARYHIAFGPVI
DGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVENIVDSDDGISASDFDFAVSNFVD
NLYGYPEGKDVLRETIKFMYTDWADRHNPETRRKTLLALFTDHQWVAPAVATADLHSNFG
SPTYFYAFYHHCQTDQVPAWADAAHGDEVPYVLGIPMIGPTELFPCNFSKNDVMLSAVVM
TYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWTRYSQKDQLYLHIGLKPRVKEHYRA
NKVNLWLELVPHLHNLNDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAFPTAKQDDPKQ
QPSPFSVDQRDYSTELSVTIAVGASLLFLNILAFAALYYKKDKRRHDVHRRCSPQRTTTN
DLTHAQEEEIMSLQMKHTDLDHECESIHPHEVVLRTACPPDYTLAMRRSPDDVPLMTPNT
ITMIPNTIPGIQPLHTFNTFTGGQNNTLPHPHPHPHSHSTTRV
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atggcactgcccagatgcacgtggccaaattatgtttggagagcagtgatggcatgcttg
gtacaccggggattgggtgccccattgactctctgtatgttgggatgtttgcttcaggct
ggccatgtgctatcacaaaaattggatgatgtggacccactggtggctaccaactttgga
aagataagagggattaagaaggaactcaataatgaaattttggggcctgttattcaattt
cttggggttccatatgcagccccaccaacaggggaacgtcgttttcagcctccagaacca
ccatctccctggtcagatatcagaaatgccactcaatttgctcctgtgtgtccccagaat
atcattgatggcagattgccagaagtcatgcttcctgtgtggtttactaataacttggat
gtggtttcatcatatgtgcaagaccagagcgaagactgcctatatttaaatatatatgtc
ccgactgaggatgatattcgggacagtgggggtcccaaaccagtgatggtgtatatccat
ggtggctcatatatggaaggtactggaaatttatatgatggaagtgtcttggcaagttat
ggcaatgtgatcgtcatcacagtcaactatcgacttggagtactcggtttcttgagtaca
ggcgatcaggctgcaaaggggaactatggactccttgatctcatacaagctttaagatgg
actagtgaaaacattggattctttggtggtgaccccttaagaatcactgtttttggatct
ggtgctgggggttcatgtgtcaacctgctgactttatcccattattctgaaggtaaccgt
tggagcaattcaaccaaaggactttttcaacgagcaatagctcaaagtggaacagccctt
tccagctgggctgttagttttcaacctgcaaaatatgctagaatgttggccacaaaagtt
ggttgcaatgtttcagatacagtagagttagtggaatgcctacagaagaagccttacaaa
gaacttgttgaccaagatattcaaccagctcgataccacatagcctttggacctgtgatt
gatggtgatgtaataccagacgacccccagatattgatggagcaaggagagtttctcaac
tatgatataatgttaggagtgaaccaaggggaagggttaaaatttgttgaaaatatagta
gatagcgatgatggtatatcagctagtgattttgactttgctgtttcaaattttgttgat
aatttatatggatatcctgaaggcaaagatgttttgagagaaaccattaagttcatgtat
actgactgggctgaccgtcataaccctgaaaccagaagaaagacattactggctttgttt
acggaccatcagtgggtggcaccagctgtagccacagcggatcttcactcaaactttggt
tcacctacgtacttctatgccttttaccatcattgccaaacagatcaggttccagcttgg
gctgatgcagcccacggagacgaggttccctatgtactgggaatccccatgattggccct
acagagttatttccttgcaatttctccaaaaatgatgtgatgctgagtgcagttgtaatg
acatactggacaaattttgctaaaactggtgacccaaatcaaccagtccctcaagacacg
aaattcattcataccaaacccaaccgttttgaagaagtagcatggaccagatattcccag
aaagaccaactttatctccatattggattaaaaccaagagttaaagaacattacagagcc
aataaggtgaacctctggttggagttggtacctcatctgcataatctcaatgacatttct
cagtatacctctacaacaactaaagtgccatcaactgacatcactttcagacctacgaga
aaaaattctgtacctgtcacgtcagcctttcccactgccaagcaggatgatcccaaacaa
caaccaagtccattttcagtggatcaaagggactactcaacagagctgagtgtcactatt
gcagttggagcatcactgctgtttctgaacatcttggcctttgcagccctgtactacaaa
aaggataagaggagacatgatgttcacaggagatgcagccctcagcgcactactaccaat
gatctaacccatgcacaagaagaggaaatcatgtccctccaaatgaagcacactgatttg
gatcatgaatgtgagtccattcatccacatgaggtggttcttcggaccgcctgtccccca
gattacacactagctatgaggaggtcacctgatgatgttcccttaatgacacccaacacc
attacaatgattcccaacactataccagggattcagcccttacacacattcaatacattt
actggaggacagaacaatactctgccccatccccatccccacccccattcacattcaaca
accagggtatag

DBGET integrated database retrieval system