KEGG   Homo sapiens (human): 22872
Entry
22872             CDS       T01001                                 

Symbol
SEC31A, ABP125, ABP130, HSPC275, HSPC334, NEDSOSB, SEC31L1
Name
(RefSeq) SEC31 homolog A, COPII coat complex component
  KO
K14005  protein transport protein SEC31
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01289  COPII vesicle formation
Disease
H02470  Neurodevelopmental disorder with structural brain abnormalities
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    22872 (SEC31A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    22872 (SEC31A)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hsa02044]
    22872 (SEC31A)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    22872 (SEC31A)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   22872 (SEC31A)
SSDB
Motif
Pfam: Sec16_C SRA1 Prp18 P3A
Other DBs
NCBI-GeneID: 22872
NCBI-ProteinID: NP_001070675
OMIM: 610257
HGNC: 17052
Ensembl: ENSG00000138674
Vega: OTTHUMG00000130297
Pharos: O94979(Tbio)
UniProt: O94979 A1LU61
Position
4q21.22
AA seq 1220 aa
MKLKEVDRTAMQAWSPAQNHPIYLATGTSAQQLDATFSTNASLEIFELDLSDPSLDMKSC
ATFSSSHRYHKLIWGPYKMDSKGDVSGVLIAGGENGNIILYDPSKIIAGDKEVVIAQNDK
HTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPMTPGAKTQPPEDISCIAWNRQV
QHILASASPSGRATVWDLRKNEPIIKVSDHSNRMHCSGLAWHPDVATQMVLASEDDRLPV
IQMWDLRFASSPLRVLENHARGILAIAWSMADPELLLSCGKDAKILCSNPNTGEVLYELP
TNTQWCFDIQWCPRNPAVLSAASFDGRISVYSIMGGSTDGLRQKQVDKLSSSFGNLDPFG
TGQPLPPLQIPQQTAQHSIVLPLKKPPKWIRRPVGASFSFGGKLVTFENVRMPSHQGAEQ
QQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKIDASQTEFEKNVWSFLKVN
FEDDSRGKYLELLGYRKEDLGKKIALALNKVDGANVALKDSDQVAQSDGEESPAAEEQLL
GEHIKEEKEESEFLPSSGGTFNISVSGDIDGLITQALLTGNFESAVDLCLHDNRMADAII
LAIAGGQELLARTQKKYFAKSQSKITRLITAVVMKNWKEIVESCDLKNWREALAAVLTYA
KPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDL
IEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIM
QLRDRLCRAQGEPVAGHESPKIPYEKQQLPKGRPGPVAGHHQMPRVQTQQYYPHGENPPP
PGFIMHGNVNPNAAGQLPTSPGHMHTQVPPYPQPQPYQPAQPYPFGTGGSAMYRPQQPVA
PPTSNAYPNTPYISSASSYTGQSQLYAAQHQASSPTSSPATSFPPPPSSGASFQHGGPGA
PPSSSAYALPPGTTGTLPAASELPASQRTGPQNGWNDPPALNRVPKKKKMPENFMPPVPI
TSPIMNPLGDPQSQMLQQQPSAPVPLSSQSSFPQPHLPGGQPFHGVQQPLGQTGMPPSFS
KPNIEGAPGAPIGNTFQHVQSLPTKKITKKPIPDEHLILKTTFEDLIQRCLSSATDPQTK
RKLDDASKRLEFLYDKLREQTLSPTITSGLHNIARSIETRNYSEGLTMHTHIVSTSNFSE
TSAFMPVLKVVLTQANKLGV
NT seq 3663 nt   +upstreamnt  +downstreamnt
atgaagttaaaggaagtagatcgtacagccatgcaggcatggagccctgcccagaatcac
cccatttacctagcaacaggaacatctgctcagcaattggatgcaacatttagtacgaat
gcttcccttgagatatttgaattagacctctctgatccatccttggatatgaaatcttgt
gccacattctcctcttctcacaggtaccacaagttgatttgggggccttataaaatggat
tccaaaggagatgtctctggagttctgattgcaggtggtgaaaatggaaatattattctc
tatgatccttctaaaattatagctggagacaaggaagttgtgattgcccagaatgacaag
catactggcccagtgagagccttggatgtgaacattttccagactaatctggtagcttct
ggtgctaatgaatctgaaatctacatatgggatctaaataattttgcaaccccaatgaca
ccaggagccaaaacacagccgccagaagatatcagctgcattgcatggaacagacaagtt
cagcatattttagcatcagccagtcccagtggccgggccactgtatgggatcttagaaaa
aatgagccaatcatcaaagtcagtgaccatagtaacagaatgcattgttctgggttggca
tggcatcctgatgttgctactcagatggtccttgcctccgaggatgaccggttaccagtg
atccagatgtgggatcttcgatttgcttcctctccacttcgtgtcctggaaaaccatgcc
agggggattttggcaattgcttggagcatggcagatcctgaattgttactgagctgtgga
aaagatgctaagattctctgctccaatccaaacacaggagaggtgttatatgaacttccc
accaacacacagtggtgcttcgatattcagtggtgtccccgaaatcctgctgtcttatca
gctgcttcgtttgatgggcgtatcagtgtttattctatcatgggaggtagcacagatggt
ttaagacagaaacaagttgacaagctttcatcatcttttgggaatcttgatccctttggc
acaggacagccccttcctccgttacaaattccacagcagactgctcagcatagtatagtg
ctgcctctgaagaagccgcccaagtggattcgaaggcctgttggtgcttctttttcattt
ggaggcaaactggttacgtttgagaatgtcagaatgccttctcatcagggagctgagcag
cagcagcagcagcaccatgtgttcattagtcaggttgtaacagaaaaggagttcctcagc
cgatcagaccaacttcagcaggctgtgcagtcacaaggatttatcaattattgccaaaaa
aaaattgatgcttctcagactgaatttgagaaaaatgtgtggtcctttttgaaggtaaac
tttgaggatgattctcgtggaaaataccttgaacttctaggatacagaaaagaagatcta
ggaaagaagattgctttggccttgaacaaagtggatggagccaatgtggctcttaaagac
tctgaccaagtagcacagagtgatggggaggagagccctgctgctgaagagcagctcttg
ggagagcacattaaagaggaaaaagaagaatctgaatttctaccctcatctggaggaaca
tttaatatctctgtcagtggggacattgatggtttaattactcaggctttgctgacgggc
aattttgagagtgctgttgacctttgtttacatgataaccgcatggccgatgccattata
ttggccatagcaggtggacaagaactcttggctcgaacccagaaaaaatacttcgcaaaa
tcccaaagcaaaattaccaggctcatcactgcagtggtgatgaagaactggaaagagatt
gttgagtcttgtgatcttaaaaattggagagaggctttagctgcagtattgacttatgca
aagccggatgaattttcagccctttgtgatcttttgggaaccaggcttgaaaatgaagga
gatagcctcctgcagactcaagcatgtctctgctatatttgtgcagggaatgtagagaaa
ttagttgcatgttggactaaagctcaagatggaagccaccctttgtcacttcaggatctg
attgagaaagttgtcatcctgcgaaaagctgtgcaactcactcaagccatggacactagt
actgtaggagttctcttggctgcgaagatgagtcagtatgccaatttgttggcagctcag
ggcagtattgctgcagccttggcttttcttcctgacaacaccaaccagccaaatatcatg
cagcttcgtgacagactttgtagagcacaaggagagcctgtagcaggacatgaatcacct
aaaattccgtacgagaaacagcagctccccaagggcaggcctggaccagttgctggccac
caccagatgccaagagttcaaactcaacaatattatccccatggagaaaatcctccacct
ccgggtttcataatgcatggaaatgttaatccaaatgctgctggtcagcttcccacatct
ccaggtcatatgcacacccaggtaccaccttatccacagccacagccttatcaaccagcc
cagccgtatcccttcggaacaggggggtcagcaatgtatcgacctcagcagcctgttgct
cctcctacttcaaacgcttaccctaacaccccttacatatcttctgcttcttcctatact
gggcagtctcagctgtacgcagcacagcaccaggcctcttcacctacctccagccctgct
acttctttccctcctcccccttcctctggagcatccttccagcatggcggaccaggagct
ccaccatcatcttcagcttatgcactgcctcctggaacaacaggtacactgcctgctgcc
agtgagctgcctgcgtcccaaagaacaggtcctcagaatggttggaatgaccctccagct
ttgaacagagtacccaaaaagaagaagatgcctgaaaacttcatgcctcctgttcccatc
acatcaccaatcatgaacccgttgggtgacccccagtcacaaatgctgcagcaacagcct
tcagctccagtaccactgtcaagccagtcttcattcccacagccacatcttccaggtggc
cagcccttccatggcgtacagcaacctcttggtcaaacaggcatgccaccatctttttca
aagcccaatattgaaggtgccccaggggctcctattggaaataccttccagcatgtgcag
tctttgccaacaaaaaaaattaccaagaaacctattccagatgagcacctcattctaaag
accacatttgaggatcttattcagcgctgcctttcttcagcaacagaccctcaaaccaag
aggaagctagatgatgccagcaaacgtttggagtttctgtatgataaacttagggaacag
acactttcaccaacaatcaccagtggtttacacaacattgcaaggagcattgaaactcga
aactactcagaaggattgaccatgcatacccacatagttagcaccagcaacttcagtgag
acctctgctttcatgccagttctcaaagttgttctcacccaggccaataagctgggtgtc
taa

KEGG   Homo sapiens (human): 25956
Entry
25956             CDS       T01001                                 

Symbol
SEC31B, SEC31B-1, SEC31L2
Name
(RefSeq) SEC31 homolog B, COPII coat complex component
  KO
K14005  protein transport protein SEC31
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01289  COPII vesicle formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    25956 (SEC31B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    25956 (SEC31B)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hsa02044]
    25956 (SEC31B)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    25956 (SEC31B)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   25956 (SEC31B)
SSDB
Motif
Pfam: Sec16_C ANAPC4_WD40 WD40
Other DBs
NCBI-GeneID: 25956
NCBI-ProteinID: NP_056305
OMIM: 610258
HGNC: 23197
Ensembl: ENSG00000075826
Vega: OTTHUMG00000019342
Pharos: Q9NQW1(Tdark)
UniProt: Q9NQW1
Position
10q24.31
AA seq 1179 aa
MKLKELERPAVQAWSPASQYPLYLATGTSAQQLDSSFSTNGTLEIFEVDFRDPSLDLKHR
GVLSALSRFHKLVWGSFGSGLLESSGVIVGGGDNGMLILYNVTHILSSGKEPVIAQKQKH
TGAVRALDLNPFQGNLLASGASDSEIFIWDLNNLNVPMTLGSKSQQPPEDIKALSWNRQA
QHILSSAHPSGKAVVWDLRKNEPIIKVSDHSNRMHCSGLAWHPDIATQLVLCSEDDRLPV
IQLWDLRFASSPLKVLESHSRGILSVSWSQADAELLLTSAKDSQILCRNLGSSEVVYKLP
TQSSWCFDVQWCPRDPSVFSAASFNGWISLYSVMGRSWEVQHMRQADKISSSFSKGQPLP
PLQVPEQVAQAPLIPPLKKPPKWIRRPTGVSFAFGGKLVTFGLPSTPAHLVPQPCPRLVF
ISQVTTESEFLMRSAELQEALGSGNLLNYCQNKSQQALLQSEKMLWQFLKVTLEQDSRMK
FLKLLGYSKDELQKKVATWLKSDVGLGESPQPKGNDLNSDRQQAFCSQASKHTTKEASAS
SAFFDELVPQNMTPWEIPITKDIDGLLSQALLLGELGPAVELCLKEERFADAIILAQAGG
TDLLKQTQERYLAKKKTKISSLLACVVQKNWKDVVCTCSLKNWREALALLLTYSGTEKFP
ELCDMLGTRMEQEGSRALTSEARLCYVCSGSVERLVECWAKCHQALSPMALQDLMEKVMV
LNRSLEQLRGPHGVSPGPATTYRVTQYANLLAAQGSLATAMSFLPRDCAQPPVQQLRDRL
FHAQGSAVLGQQSPPFPFPRIVVGATLHSKETSSYRLGSQPSHQVPTPSPRPRVFTPQSS
PAMPLAPSHPSPYQGPRTQNISDYRAPGPQAIQPLPLSPGVRPASSQPQLLGGQRVQVPN
PVGFPGTWPLPGSPLPMACPGIMRPGSTSLPETPRLFPLLPLRPLGPGRMVSHTPAPPAS
FPVPYLPGDPGAPCSSVLPTTGILTPHPGPQDSWKEAPAPRGNLQRNKLPETFMPPAPIT
APVMSLTPELQGILPSQPPVSSVSHAPPGVPGELSLQLQHLPPEKMERKELPPEHQSLKS
SFEALLQRCSLSATDLKTKRKLEEAAQRLEYLYEKLCEGTLSPHVVAGLHEVARCVDAGS
FEQGLAVHAQVAGCSSFSEVSSFMPILKAVLIIAHKLLV
NT seq 3540 nt   +upstreamnt  +downstreamnt
atgaagctgaaggaacttgagcggccagctgtccaggcatggagcccagccagccaatac
cctttgtatctggccacaggaacatctgcccaacagctagattcctccttcagcacaaat
ggcacattggaaatatttgaggttgatttcagggacccttctctggacttgaaacacaga
ggagtcctttctgccttgagcaggtttcacaagctggtctgggggagctttggcagtggg
cttctggaaagctccggggttattgttggcggcggggacaatggcatgcttattctatac
aatgtgacccacatcctgtcttcggggaaggagcctgtgattgctcagaaacagaagcac
acgggggctgtcagagccctcgacttgaatcctttccagggcaacctcctggcttcaggg
gccagcgattctgaaatcttcatttgggatctgaataacttgaatgtgccaatgaccctg
ggatccaagtcacagcagcctccagaggacatcaaggcactgtcttggaaccggcaagcc
caacacattctgtcttctgctcaccccagtggcaaggcagttgtgtgggatctcaggaag
aatgaacctatcatcaaagtcagtgatcacagcaacaggatgcactgctcaggcctggcc
tggcatcctgacatagccacccagttagtgctgtgctcagaggatgatcgacttcccgtg
attcagctgtgggacttgcgctttgcctcctcgcccttgaaggtgctggagagccacagc
agggggatcttgtcagtgtcatggagccaggctgatgctgagctgctgctcactagtgct
aaggacagccagatcttgtgccggaacctggggagcagtgaggtggtatataagctacca
acacagagcagctggtgctttgatgtgcagtggtgccctcgggacccttcagtgttctct
gctgcctccttcaacggctggatcagtttgtactctgtgatgggtaggagctgggaagtc
cagcatatgagacaggctgacaagatctcctcttccttcagcaaaggccagcctctccca
ccactgcaggtgccagagcaagtggcacaagcaccactgatacctcccctgaaaaaaccc
cccaaatggattagaagaccaacaggtgtttcatttgcttttggagggaagctggttact
tttggcctccccagcacccctgcccatctggtgccacagccttgcccccgcctagtcttc
atcagtcaagtcaccacagaatctgaattcctgatgcgatcagctgagctgcaggaggcc
ttgggatcaggaaatctactgaattactgtcagaacaagagccagcaagctttactgcaa
agtgaaaagatgctgtggcagttcctgaaggtgaccttagagcaagactccagaatgaaa
ttcctaaagcttttaggatacagtaaagatgagcttcagaagaaggtggccacatggttg
aagagtgacgtggggctaggtgagagtcctcagcccaagggaaatgacctcaacagtgac
agacaacaggccttctgcagccaggcctccaaacacaccacaaaggaagcctctgcttcc
tcagccttctttgatgagctggtccctcagaacatgactccttgggagatccccatcaca
aaagatattgatggactcctaagccaggctctcctgcttggggaactgggtccggccgtg
gagctgtgtctgaaggaggagcgctttgctgatgccattatcctggcccaggctgggggt
acagatctgctgaagcaaacacaggagcgctacttggccaagaagaaaaccaaaatctcc
tcgcttctagcctgtgttgtgcaaaagaattggaaggatgtggtgtgtacctgtagcctg
aagaactggagagaggcactggctttgctactgacatactcaggcacagagaaatttccc
gagctctgtgacatgctgggaactcgcatggaacaggagggcagcagggcactaacctcc
gaagccagactctgttatgtgtgctcagggagtgtggagcggctggtggagtgctgggca
aaatgccaccaggctttgtcccccatggctctgcaggacctgatggagaaggtgatggtt
cttaacaggagcttggagcaactgcggggtcctcatggggtgagcccaggccctgccaca
acctacagggtcactcagtatgccaacctcctggcagcccagggcagcctggccactgcc
atgagctttctacccagggactgtgctcagccaccagttcagcagctaagagatcggctt
tttcatgctcaaggttctgctgtcttgggccaacagtctccccctttccccttcccccgg
attgttgtgggagctaccctccactctaaagagacatcatcttacagattgggatcccag
ccttctcaccaggtcccaactccatctccaaggccaagggttttcacccctcagtcatca
ccagcgatgcccttggcaccttcccatcctagcccttatcagggtcccaggacacagaat
ataagtgactacagggcacctgggccccaggccatccagcctttgcctttgagccctggg
gtaaggcctgcttcatctcagccacagctattaggagggcaaagggtgcaagttcctaac
ccggtgggattccctgggacatggcctcttcctggttcccctctacccatggcatgccca
ggcatcatgcgacctggctctacctccctgcctgagactcctagactgttccctctgctt
cctctgagaccactaggtcccggccgcatggtctcccacaccccagcccctcctgcaagc
ttccctgtgccataccttccaggggacccaggtgccccatgctctagtgtcctcccaacc
actggcatcttgactcctcacccaggacctcaagattcctggaaagaagccccagccccc
aggggaaacctccagaggaacaagctgccagagacatttatgcccccagcaccaattact
gctccagttatgagcctcacccctgagctacaagggattcttccctcacagccccctgtc
tccagtgtgagtcatgctcccccaggagttccaggagaactcagcctgcagcttcagcac
ctgccacctgagaagatggaaaggaaggagctgcccccagagcatcagtccttgaagagc
agctttgaggcgcttctccaacgctgctccctgtctgcaactgacttaaagacaaaaagg
aagctggaagaggcagcccagcgtctggagtatctatatgagaagctctgtgaggggaca
ctctcacctcatgtcgtggctgggctccatgaggttgcccgatgtgtggatgcaggaagc
tttgagcagggccttgcagtgcatgcccaggtggcgggctgtagcagcttcagcgaggtg
tccagcttcatgcctatcctgaaggctgtcctcatcatcgctcataagctgctggtctaa

KEGG   Homo sapiens (human): 6396
Entry
6396              CDS       T01001                                 

Symbol
SEC13, D3S1231E, SEC13L1, SEC13R, npp-20
Name
(RefSeq) SEC13 homolog, nuclear pore and COPII coat complex component
  KO
K14004  protein transport protein SEC13
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa04141  Protein processing in endoplasmic reticulum
hsa04150  mTOR signaling pathway
hsa05014  Amyotrophic lateral sclerosis
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01289  COPII vesicle formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    6396 (SEC13)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6396 (SEC13)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    6396 (SEC13)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    6396 (SEC13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    6396 (SEC13)
   04131 Membrane trafficking [BR:hsa04131]
    6396 (SEC13)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     6396 (SEC13)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    6396 (SEC13)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    6396 (SEC13)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 6396
NCBI-ProteinID: NP_899195
OMIM: 600152
HGNC: 10697
Ensembl: ENSG00000157020
Vega: OTTHUMG00000128671
Pharos: P55735(Tbio)
UniProt: P55735
Structure
PDB: 
3BG1 3BG0 5A9Q

Position
3p25.3
AA seq 322 aa
MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPV
WQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLIL
ACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIK
RFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRV
FIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCI
SDVNKGQGSVSASVTEGQQNEQ
NT seq 969 nt   +upstreamnt  +downstreamnt
atggtgtcagtaattaacactgtggatacctcccatgaggacatgattcacgacgcccag
atggactactatggcacccgcctggcaacctgctcatcagacaggtccgtcaaaatcttt
gatgtgcgcaatggagggcagatccttatcgccgacctcaggggtcatgagggtcctgtg
tggcaagtggcctgggctcaccccatgtacggcaacatcctggcatcgtgctcctatgac
cggaaagtcattatctggagagaggaaaacggcacctgggagaagagccacgagcatgcg
ggacacgactcctcagtgaactcggtgtgctgggccccccatgactacggcctgatcctg
gcctgtgggagctcggatggggccatctccctgctgacttacaccggggaaggccaatgg
gaagtaaagaagatcaacaacgctcacaccattggctgcaatgccgtcagctgggcccct
gctgttgtacctggaagcctcatagaccacccatcggggcagaaacccaattacatcaag
aggtttgcatcaggtggctgtgacaacctcatcaagctgtggaaggaggaggaggacggc
cagtggaaggaggagcagaagctagaagcgcacagtgactgggttcgagatgtggcctgg
gccccctccatcggcctgcccaccagcaccatcgccagctgctcccaggatggtcgtgtg
ttcatttggacctgtgatgatgcctcaagcaatacgtggtcccctaaattgttgcacaag
ttcaacgatgtggtgtggcatgtgagctggtccatcacagccaacatcctggctgtctct
ggtggagacaataaggtgaccctgtggaaggagtcagttgatgggcagtgggtgtgcatc
agtgatgtcaacaagggccagggctccgtatcagcatcagtgacagagggccagcagaac
gagcagtga

DBGET integrated database retrieval system