KEGG   Homo sapiens (human): 22875Help
Entry
22875             CDS       T01001                                 

Gene name
ENPP4, NPP4
Definition
(RefSeq) ectonucleotide pyrophosphatase/phosphodiesterase 4
  KO
K18424  ectonucleotide pyrophosphatase/phosphodiesterase family member 4 [EC:3.6.1.29]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    22875 (ENPP4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     22875 (ENPP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphodiest Sulfatase Metalloenzyme PglZ DUF1501
Motif
Other DBs
NCBI-GeneID: 22875
NCBI-ProteinID: NP_055751
OMIM: 617000
HGNC: 3359
Ensembl: ENSG00000001561
Vega: OTTHUMG00000014779
Pharos: Q9Y6X5(Tbio)
UniProt: Q9Y6X5
Structure
PDB: 

Position
6p21.1
AA seq 453 aa AA seqDB search
MKLLVILLFSGLITGFRSDSSSSLPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVE
HVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIW
VTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTF
ATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGM
TQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIP
NRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGY
KHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCINLPEAIAIVIGSLLVLTM
LTCLIIIMQNRLSVPRPFSRLQLQEDDDDPLIG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaagttattagtaatacttttgttttctggacttataactggttttagaagtgactct
tcctctagtttgccacctaagttactactagtatcctttgatggcttcagagctgattat
ctgaagaactatgaatttcctcatctccagaattttatcaaagaaggtgttttggtagag
catgttaaaaatgtttttatcacaaaaacatttccaaaccactacagtattgtgacaggc
ttgtatgaagaaagccatggcattgtggctaattccatgtatgatgcagtcacaaagaaa
cacttttctgactctaatgacaaggatcctttttggtggaatgaggcagtacctatttgg
gtgaccaatcagcttcaggaaaacagatcaagtgctgctgctatgtggcctggtactgat
gtacccattcacgataccatctcttcctattttatgaattacaactcctcagtgtcattt
gaggaaagactaaataatattactatgtggctaaacaattcgaacccaccagtcaccttt
gcaacactatattgggaagaaccagatgcaagtggccacaaatacggacctgaagataaa
gaaaacatgagcagagtgttgaaaaaaatagatgatcttatcggtgacttagtccaaaga
ctcaagatgttagggctatgggaaaatcttaatgtgatcattacaagtgatcatgggatg
acccagtgttctcaggacagactgataaacctggattcctgcatcgatcattcatactac
actcttatagatttgagcccagttgctgcaatacttcccaaaataaatagaacagaggtt
tataacaaactgaaaaactgtagccctcatatgaatgtttatctcaaagaagacattcct
aacagattttattaccaacataatgatcgaattcagcccattattttggttgccgatgaa
ggctggacaattgtgctaaatgaatcatcacaaaaattaggtgaccatggttatgataat
tctttgcctagtatgcatccatttctagctgcccacggacctgcatttcacaaaggctac
aagcatagcacaattaacattgtggatatttatccaatgatgtgccacatcctgggatta
aaaccacatcccaataatgggacctttggtcatactaagtgcttgttagttgaccagtgg
tgcattaatctcccagaagccatcgcgattgttatcggttcactcttggtgttaaccatg
ctaacatgcctcataataatcatgcagaatagactttctgtacctcgtccattttctcga
cttcagctacaagaagatgatgatgatcctttaattgggtga

DBGET integrated database retrieval system