KEGG   Homo sapiens (human): 2288Help
Entry
2288              CDS       T01001                                 

Gene name
FKBP4, FKBP51, FKBP52, FKBP59, HBI, Hsp56, PPIase, p52
Definition
(RefSeq) FKBP prolyl isomerase 4
  KO
K09571  FK506-binding protein 4/5 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    2288 (FKBP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    2288 (FKBP4)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     2288 (FKBP4)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    2288 (FKBP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_1 TPR_2 TPR_8 TPR_12 TPR_11 FKBP_N_2 TPR_16 TPR_6 TPR_14 TPR_19 TPR_7 TPR_9 PknG_TPR TPR_17 DUF3856
Motif
Other DBs
NCBI-GeneID: 2288
NCBI-ProteinID: NP_002005
OMIM: 600611
HGNC: 3720
Ensembl: ENSG00000004478
Vega: OTTHUMG00000090429
Pharos: Q02790(Tchem)
UniProt: Q02790
Structure
PDB: 

Position
12p13.33
AA seq 459 aa AA seqDB search
MTAEEMKATESGAQSAPLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGW
LLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPP
KIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKD
KLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPN
AELKYELHLKSFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWL
EYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRG
EAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAE
EENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgacagccgaggagatgaaggcgaccgagagcggggcgcagtcggcgccgctgcccatg
gagggagtggacatcagccccaaacaggacgaaggcgtgctgaaggtcatcaagagagag
ggcacaggtacagagatgcccatgattggggaccgagtctttgtccactacactggctgg
ctattagatggcacaaagtttgactccagtctggatcgcaaggacaaattctcctttgac
ctgggaaaaggggaggtcatcaaggcttgggacattgccatagccaccatgaaggtgggg
gaggtgtgccacatcacctgcaaaccagaatatgcctacggttcagcaggcagtcctcca
aagattccccccaatgccacgcttgtatttgaggtggagttgtttgagtttaagggagaa
gatctgacggaagaggaagatggcggaatcattcgcagaatacagactcgcggtgaaggc
tatgctaagcccaatgagggtgctatcgtggaggttgcactggaagggtactacaaggac
aagctctttgaccagcgggagctccgctttgagattggcgagggggagaacctggatctg
ccttatggtctggagagggccattcagcgcatggagaaaggagaacattccatcgtgtac
ctcaagcccagctatgcttttggcagtgttgggaaggaaaagttccaaatcccaccaaat
gctgagctgaaatatgaattacacctcaagagttttgaaaaggccaaggagtcttgggag
atgaattcagaagagaagctggaacagagcaccatagtgaaagagcggggcactgtgtac
ttcaaggaaggtaaatacaagcaagctttactacagtataagaagatcgtgtcttggctg
gaatatgagtctagtttttccaatgaggaagcacagaaagcacaggcccttcgactggcc
tctcacctcaacctggccatgtgtcatctgaaactacaggccttctctgctgccattgaa
agctgtaacaaggccctagaactggacagcaacaacgagaagggcctcttccgccgggga
gaggcccacctggccgtgaatgactttgaactggcacgggctgatttccagaaggtcctg
cagctctaccccaacaacaaagccgccaagacccagctggctgtgtgccagcagcggatc
cgaaggcagcttgcccgggagaagaagctctatgccaatatgtttgagaggctggctgag
gaggagaacaaggccaaggcagaggcttcctcaggagaccatcccactgacacagagatg
aaggaggagcagaagagcaacacggcagggagccagtctcaggtggagacagaagcatag

DBGET integrated database retrieval system