KEGG   Homo sapiens (human): 22881
Entry
22881             CDS       T01001                                 
Symbol
ANKRD6
Name
(RefSeq) ankyrin repeat domain 6
  KO
K21435  ankyrin repeat domain-containing protein 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    22881 (ANKRD6)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Kinases and associated factors
    Kinase anchoring protein
     22881 (ANKRD6)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3 Apolipo_F DUF445 Phasin Pacs-1 CLZ Syntaxin_2
Other DBs
NCBI-GeneID: 22881
NCBI-ProteinID: NP_001229738
OMIM: 610583
HGNC: 17280
Ensembl: ENSG00000135299
Pharos: Q9Y2G4(Tbio)
UniProt: Q9Y2G4 B7Z3D2
Position
6:89433152..89633834
AA seq 727 aa
MSQQDAVAALSERLLVAAYKGQTENVVQLINKGARVAVTKHGRTPLHLAANKGHLPVVQI
LLKAGCDLDVQDDGDQTALHRATVVGNTEIIAALIHEGCALDRQDKDGNTALHEASWHGF
SQSAKLLIKAGANVLAKNKAGNTALHLACQNSHSQSTRVLLLAGSRADLKNNAGDTCLHV
AARYNHLSIIRLLLTAFCSVHEKNQAGDTALHVAAALNHKKVAKILLEAGADTTIVNNAG
QTPLETARYHNNPEVALLLTKAPQVLRFSRGRSLRKKRERLKEERRAQSVPRDEVAQSKG
SVSAGDTPSSEQAVARKEEAREEFLSASPEPRAKDDRRRKSRPKVSAFSDPTPPADQQPG
HQKNLHAHNHPKKRNRHRCSSPPPPHEFRAYQLYTLYRGKDGKVMQAPINGCRCEPLINK
LENQLEATVEEIKAELGSVQDKMNTKLGQMENKTQHQMRVLDKLMVERLSAERTECLNRL
QQHSDTEKHEGEKRQISLVDELKTWCMLKIQNLEQKLSGDSRACRAKSTPSTCESSTGVD
QLVVTAGPAAASDSSPPVVRPKEKALNSTATQRLQQELSSSDCTGSRLRNVKVQTALLPM
NEAARSDQQAGPCVNRGTQTKKSGKSGPTRHRAQQPAASSTCGQPPPATGSEQTGPHIRD
TSQALELTQYFFEAVSTQMEKWYERKIEEARSQANQKAQQDKATLKEHIKSLEEELAKLR
TRVQKEN
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgagccagcaagatgcggtcgctgcactttcagagcgccttctcgtagctgcgtacaaa
ggccaaacagagaatgtggttcagctcatcaacaagggcgccagggtagcggttaccaag
catggccggactcccctgcatcttgctgccaataagggccatcttcctgtggtccagatc
ttgctgaaggctggctgcgaccttgatgtccaggatgatggggaccagaccgccttgcac
cgggccacagtggtggggaacacggagatcatcgcggcgctcatccacgaagggtgtgcc
ctggacagacaagacaaggatgggaatacagccttgcatgaagcatcctggcatggtttc
agccagtcagccaagctgctcattaaagcaggagccaacgtgcttgccaagaacaaggcg
gggaacacagctctgcacctggcctgccagaacagccactcccagagcacgcgcgtcctc
ctgctggccgggtcccgcgctgacctcaaaaataatgcaggagacacctgtttgcacgtt
gctgcgcgctataatcacttgtccatcattaggctcctcctcactgctttctgttctgtc
catgaaaagaaccaggctggagacacagcacttcacgttgctgctgccctaaatcacaag
aaggtggccaaaatcttactggaagccggagcagatacgaccattgttaacaatgcaggc
cagactccgctggagactgcccgctaccacaataacccggaagttgctcttctccttact
aaagctccccaggtcttgcgcttcagtcgtgggcgaagcctgaggaaaaagagagagagg
ctcaaggaagagaggagagcccagtctgtgccaagagatgaggtggcccaaagcaagggc
agtgtctcagcaggagacacccccagcagtgaacaggctgtggccagaaaagaagaagcc
agagaagagttcctgtcagcctccccagaacccagagcaaaggatgacaggaggagaaag
tcaaggcccaaggtgtcagcattttctgaccccaccccaccagccgaccaacagcctgga
caccagaagaacctgcatgctcataatcaccctaaaaagaggaacaggcatcggtgttca
tccccacccccaccccatgagttcagggcgtatcagctctacacattgtaccggggcaag
gatgggaaagtgatgcaggcaccaataaatggttgtcgatgtgaacctctaatcaacaag
ctggagaatcagttggaggctactgtggaggagataaaagcagagctgggatcggttcag
gacaaaatgaatacaaagctggggcagatggagaataagacccagcaccaaatgcgtgtt
ttggacaagctgatggttgagcgactttctgcagagaggacggagtgcctgaaccgcctg
caacagcactcagacacagagaagcatgagggggagaaacgacagatatccttggtggat
gaattaaaaacctggtgcatgttaaagattcagaatctggagcagaagctttctggagat
tctagggcctgcagagctaaatccacaccatctacttgtgagtcctctacaggtgtggac
caattagtggtgactgcaggtccagcagcagcttccgacagctcccctccagtggttagg
cccaaagagaaggccctcaactccactgctacccagagactccagcaggagctgtcgtct
tctgactgtacaggctcccgactgagaaacgtcaaggtccagacagccttgctacccatg
aatgaggcagccagatctgatcagcaggctgggccctgcgtcaacagaggcactcaaact
aagaagtctgggaagagtgggccaacaaggcatcgtgcccagcaacccgcagccagcagc
acctgtgggcagccgccaccagccacaggcagcgagcagactggccctcacattcgggac
acctcccaagctctggagcttacccagtatttttttgaggctgtttctacccagatggaa
aagtggtatgaaaggaagattgaagaagcacgaagccaagccaatcagaaagcccagcaa
gataaggctacattgaaggaacacattaaaagtttagaagaggaacttgccaaactaagg
actagggtgcagaaggaaaattag

DBGET integrated database retrieval system