KEGG   Homo sapiens (human): 22885
Entry
22885             CDS       T01001                                 
Symbol
ABLIM3, HMFN1661
Name
(RefSeq) actin binding LIM protein family member 3
  KO
K07520  actin-binding LIM protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    22885 (ABLIM3)
SSDB
Motif
Pfam: AbLIM_anchor LIM VHP
Other DBs
NCBI-GeneID: 22885
NCBI-ProteinID: NP_001287944
OMIM: 611305
HGNC: 29132
Ensembl: ENSG00000173210
Pharos: O94929(Tdark)
UniProt: O94929
Structure
Position
5:149141493..149260542
AA seq 683 aa
MNTSIPYQQNPYNPRGSSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSG
FFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDK
VTFSGKECVCQTCSQSMASSKPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQT
CSVILTGEYISKDGVPYCESDYHAQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCH
QMFTEGEEMYLTGSEVWHPICKQAARAEKKLKHRRTSETSISPPGSSIGSPNRVICAKVD
NEILNYKDLAALPKVKSIYEVQRPDLISYEPHSRYMSDEMLERCGYGESLGTLSPYSQDI
YENLDLRQRRASSPGYIDSPTYSRQGMSPTFSRSPHHYYRSGPESGRSSPYHSQLDVRSS
TPTSYQAPKHFHIPAGDSNIYRKPPIYKRHGDLSTATKSKTSEDISQTSKYSPIYSPDPY
YASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYAD
PWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSA
DLFHYDSMNAVNWGMREYKIYPYELLLVTTRGRNRLPKDVDRTRLERHLSQEEFYQVFGM
TISEFDRLALWKRNELKKQARLF
NT seq 2052 nt   +upstreamnt  +downstreamnt
atgaacactagcattccttatcagcagaatccttacaatccacggggcagctccaatgtc
atccagtgctaccgctgtggagacacctgcaaaggggaagtggtccgcgtgcacaacaac
cacttccacatcagatgcttcacctgtcaagtatgtggctgtggcctggcccagtcaggc
ttcttcttcaagaaccaggagtacatctgcacccaggactaccagcaactctatggcacc
cgctgtgacagctgccgggacttcatcacaggcgaagtcatctcggccctgggccgcact
taccaccccaagtgcttcgtgtgcagcttgtgcaggaagcctttccccattggagacaag
gtgaccttcagcggtaaagaatgtgtgtgccaaacgtgctcccagtccatggccagcagt
aagcccatcaagattcgtggaccaagccactgtgccgggtgcaaggaggagatcaagcac
ggccagtcactcctggctctggacaagcagtggcacgtcagctgcttcaagtgccagacc
tgcagcgtcatcctcaccggggagtatatcagcaaggatggtgttccatactgtgagtcc
gactaccatgcccagtttggcattaaatgtgagacttgtgaccgatacatcagtggcaga
gtcttggaggcaggagggaagcactaccacccaacctgtgccaggtgtgtacgctgccac
cagatgttcaccgaaggagaggaaatgtacctcacaggttccgaggtttggcaccccatc
tgcaaacaggcagcccgggcagagaagaagttaaagcatagacggacatctgaaacctcc
atctcaccccctggatccagcattgggtcacccaaccgagtcatctgcgctaaagtggat
aatgagatccttaattacaaagacctggcggctctccccaaggttaagtctatctacgag
gtacaacgccccgacctcatttcctatgagcctcattccagatacatgtccgacgagatg
ctggagagatgtggctatggagagtcgctgggaacattatctccctactcccaggacatc
tacgagaacctggacctccggcagagacgggcctccagcccggggtacatagactccccc
acctacagccggcagggcatgtcccccaccttctcccgctcacctcaccactactaccgc
tctgggcccgagagtggccggagctctccataccatagccagttagatgtgaggtcctcc
actccaacctcttaccaggctcccaagcactttcacatcccagctggagacagtaacatc
taccggaaacccccgatctacaaacggcatggtgatttgtctacagcaaccaagagcaaa
acaagtgaagacatcagccagacctccaagtacagtcccatctactcgccagacccctac
tatgcttcggagtctgagtactggacctaccatgggtcccccaaagtgccccgagccaga
aggttctcgtctggaggagaggaggatgattttgaccgcagcatgcacaagctccaaagt
ggaattggccggctgattctgaaggaagaaatgaaggcccggtcgagctcctatgcagat
ccctggacccctccccggagctccaccagcagccgggaagccctgcacacagctggctat
gagatgtccctcaatggctcccctcggtcgcactacctggctgacagtgatcctctcatc
tccaaatctgcctccctgcctgcctaccgaagaaatgggctgcacaggacacccagcgca
gacctcttccactacgacagcatgaacgcagtcaactggggcatgcgagagtacaagatc
tacccttatgaactgctgctggtgactacaagaggaagaaaccgactgcccaaggatgta
gacaggacccgtttagagcgccacctgtcccaggaagagttctaccaagtctttggcatg
accatctctgagtttgaccggctggccctctggaagaggaatgaactgaagaagcaagcc
cggctgttctag

DBGET integrated database retrieval system