KEGG   Homo sapiens (human): 22885
Entry
22885             CDS       T01001                                 

Symbol
ABLIM3, HMFN1661
Name
(RefSeq) actin binding LIM protein family member 3
  KO
K07520  actin-binding LIM protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    22885 (ABLIM3)
SSDB
Motif
Pfam: AbLIM_anchor LIM VHP
Other DBs
NCBI-GeneID: 22885
NCBI-ProteinID: NP_001287944
OMIM: 611305
HGNC: 29132
Ensembl: ENSG00000173210
Vega: OTTHUMG00000129932
Pharos: O94929(Tdark)
UniProt: O94929
Structure
PDB: 
2DJ7 1UJS

Position
5q32
AA seq 683 aa
MNTSIPYQQNPYNPRGSSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSG
FFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDK
VTFSGKECVCQTCSQSMASSKPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQT
CSVILTGEYISKDGVPYCESDYHAQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCH
QMFTEGEEMYLTGSEVWHPICKQAARAEKKLKHRRTSETSISPPGSSIGSPNRVICAKVD
NEILNYKDLAALPKVKSIYEVQRPDLISYEPHSRYMSDEMLERCGYGESLGTLSPYSQDI
YENLDLRQRRASSPGYIDSPTYSRQGMSPTFSRSPHHYYRSGPESGRSSPYHSQLDVRSS
TPTSYQAPKHFHIPAGDSNIYRKPPIYKRHGDLSTATKSKTSEDISQTSKYSPIYSPDPY
YASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYAD
PWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSA
DLFHYDSMNAVNWGMREYKIYPYELLLVTTRGRNRLPKDVDRTRLERHLSQEEFYQVFGM
TISEFDRLALWKRNELKKQARLF
NT seq 2052 nt   +upstreamnt  +downstreamnt
atgaacactagcattccttatcagcagaatccttacaatccacggggcagctccaatgtc
atccagtgctaccgctgtggagacacctgcaaaggggaagtggtccgcgtgcacaacaac
cacttccacatcagatgcttcacctgtcaagtatgtggctgtggcctggcccagtcaggc
ttcttcttcaagaaccaggagtacatctgcacccaggactaccagcaactctatggcacc
cgctgtgacagctgccgggacttcatcacaggcgaagtcatctcggccctgggccgcact
taccaccccaagtgcttcgtgtgcagcttgtgcaggaagcctttccccattggagacaag
gtgaccttcagcggtaaagaatgtgtgtgccaaacgtgctcccagtccatggccagcagt
aagcccatcaagattcgtggaccaagccactgtgccgggtgcaaggaggagatcaagcac
ggccagtcactcctggctctggacaagcagtggcacgtcagctgcttcaagtgccagacc
tgcagcgtcatcctcaccggggagtatatcagcaaggatggtgttccatactgtgagtcc
gactaccatgcccagtttggcattaaatgtgagacttgtgaccgatacatcagtggcaga
gtcttggaggcaggagggaagcactaccacccaacctgtgccaggtgtgtacgctgccac
cagatgttcaccgaaggagaggaaatgtacctcacaggttccgaggtttggcaccccatc
tgcaaacaggcagcccgggcagagaagaagttaaagcatagacggacatctgaaacctcc
atctcaccccctggatccagcattgggtcacccaaccgagtcatctgcgctaaagtggat
aatgagatccttaattacaaagacctggcggctctccccaaggttaagtctatctacgag
gtacaacgccccgacctcatttcctatgagcctcattccagatacatgtccgacgagatg
ctggagagatgtggctatggagagtcgctgggaacattatctccctactcccaggacatc
tacgagaacctggacctccggcagagacgggcctccagcccggggtacatagactccccc
acctacagccggcagggcatgtcccccaccttctcccgctcacctcaccactactaccgc
tctgggcccgagagtggccggagctctccataccatagccagttagatgtgaggtcctcc
actccaacctcttaccaggctcccaagcactttcacatcccagctggagacagtaacatc
taccggaaacccccgatctacaaacggcatggtgatttgtctacagcaaccaagagcaaa
acaagtgaagacatcagccagacctccaagtacagtcccatctactcgccagacccctac
tatgcttcggagtctgagtactggacctaccatgggtcccccaaagtgccccgagccaga
aggttctcgtctggaggagaggaggatgattttgaccgcagcatgcacaagctccaaagt
ggaattggccggctgattctgaaggaagaaatgaaggcccggtcgagctcctatgcagat
ccctggacccctccccggagctccaccagcagccgggaagccctgcacacagctggctat
gagatgtccctcaatggctcccctcggtcgcactacctggctgacagtgatcctctcatc
tccaaatctgcctccctgcctgcctaccgaagaaatgggctgcacaggacacccagcgca
gacctcttccactacgacagcatgaacgcagtcaactggggcatgcgagagtacaagatc
tacccttatgaactgctgctggtgactacaagaggaagaaaccgactgcccaaggatgta
gacaggacccgtttagagcgccacctgtcccaggaagagttctaccaagtctttggcatg
accatctctgagtttgaccggctggccctctggaagaggaatgaactgaagaagcaagcc
cggctgttctag

KEGG   Homo sapiens (human): 3983
Entry
3983              CDS       T01001                                 

Symbol
ABLIM1, ABLIM, LIMAB1, LIMATIN, abLIM-1
Name
(RefSeq) actin binding LIM protein 1
  KO
K07520  actin-binding LIM protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    3983 (ABLIM1)
SSDB
Motif
Pfam: AbLIM_anchor LIM VHP
Other DBs
NCBI-GeneID: 3983
NCBI-ProteinID: NP_002304
OMIM: 602330
HGNC: 78
Ensembl: ENSG00000099204
Vega: OTTHUMG00000019088
Pharos: O14639(Tbio)
UniProt: O14639
Position
10q25.3
AA seq 778 aa
MPAFLGLKCLGKLCSSEKSKVTSSERTSARGSNRKRLIVEDRRVSGTSFTAHRRATITHL
LYLCPKDYCPRGRVCNSVDPFVAHPQDPHHPSEKPVIHCHKCGEPCKGEVLRVQTKHFHI
KCFTCKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPN
CFACTICKRPFPPGDRVTFNGRDCLCQLCAQPMSSSPKETTFSSNCAGCGRDIKNGQALL
ALDKQWHLGCFKCKSCGKVLTGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAG
DKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTRTSSESIYSRP
GSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQER
QSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRP
GNEPSSGRNSPLPYRPDSRPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHAALAAQSKS
SEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAVVGPDMKRRSSGREEDDEELLRRR
QLQEEQLMKLNSGLGQLILKEEMEKESRERSSLLASRYDSPINSASHIPSSKTASLPGYG
RNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEM
LMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF
NT seq 2337 nt   +upstreamnt  +downstreamnt
atgcctgccttccttggtctaaagtgtctggggaaattgtgcagctctgagaaaagcaaa
gtcacctcatctgagagaaccagtgccaggggctcgaacagaaagagactgattgttgag
gaccggagggtctctgggacctccttcaccgctcataggcgtgccactatcactcatttg
ctgtatctctgtcccaaggactactgcccacgtgggcgtgtatgtaacagcgttgatcct
tttgtggcccaccctcaggaccctcaccacccatcagagaagcctgtcattcactgccat
aaatgtggggagccttgcaagggtgaagtgcttcgggtccagaccaaacatttccacatc
aagtgtttcacctgcaaagtgtgtggctgtgacctggcacaagggggcttcttcataaag
aacggagagtatctctgcaccctggactaccagcggatgtacgggacacgctgccatggc
tgtggggagttcgtggagggcgaagtggtgactgctctgggcaagacctaccatcccaat
tgctttgcttgtactatctgcaagcgcccgtttccacccggagaccgagtcacattcaat
gggagagactgcctttgtcaactctgtgcacagccgatgtcgtccagtccgaaagaaacc
accttctccagcaattgtgccggctgcggaagagatatcaagaatgggcaggcgctgctg
gcgctggataagcagtggcacttggggtgctttaaatgcaagtcctgcgggaaggtcctc
accggggagtacatcagcaaggatggtgctccgtactgtgaaaaggactaccagggactc
tttggggtgaaatgtgaggcgtgtcaccagtttatcacagggaaagtcctggaggcaggt
gacaaacattaccaccccagctgtgcacgatgcagcagatgcaaccagatgttcacagaa
ggagaggaaatgtatcttcaaggctccaccgtttggcatcccgactgtaagcaatctacg
aagaccgaggaaaagctgcggcctaccaggacatcctcggaaagtatttattctaggcca
ggctccagtattcctggctcaccaggtcatactatctatgcaaaagtagacaatgagatc
ctggattacaaggatttagcagccattccgaaggtcaaggcaatttatgacattgaacgt
ccagatcttattacctatgagcctttctacacttcgggctatgatgacaaacaggagaga
cagagccttggagagtctccgaggactttgtctcctactccatcagcagaagggtaccag
gatgttcgggatcggatgatccatcggtccacgagccagggctccatcaactcccctgtg
tacagccgccacagctacactccaaccacgtcccgctctccccagcatttccacagacct
ggcaatgagccgtccagcggccggaactcccctctcccttaccggccagacagccgccct
ctaactccaacttacgctcaggcccctaaacatttccatgttccagatcaaggaatcaac
atttaccgaaagccacccatctacaaacagcatgctgccttggcagcccagagcaagtcc
tcagaagatatcatcaagttttccaagttcccagcagcccaggcaccagaccccagcgag
acaccaaagattgagacggaccactggcctggtcccccctcatttgctgtcgtaggacct
gacatgaaacgcagatctagtggcagagaggaagatgatgaggaacttctgagacgtcgg
cagcttcaagaagagcaattaatgaagcttaactcaggcctgggacagttgatcttgaaa
gaagagatggagaaagagagccgggaaaggtcatctctgttagccagtcgctacgattct
cccatcaactcagcttcacatattccatcatctaaaactgcatctctccctggctatgga
agaaatgggcttcaccggcctgtttctaccgacttcgctcagtataacagctatggggat
gtcagcgggggagtgcgagattaccagacactcccagatggccacatgcctgcaatgaga
atggaccgaggagtgtctatgcccaacatgttggaaccaaagatatttccatatgaaatg
ctcatggtgaccaacagagggcgaaacaaaatcctcagagaggtggacagaaccaggctg
gagcgccacttagcccctgaagtgtttcgggaaatctttggaatgtccatacaggagttt
gacaggttacctctttggagacgcaacgacatgaagaaaaaagcaaaactcttctaa

KEGG   Homo sapiens (human): 84448
Entry
84448             CDS       T01001                                 

Symbol
ABLIM2
Name
(RefSeq) actin binding LIM protein family member 2
  KO
K07520  actin-binding LIM protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    84448 (ABLIM2)
SSDB
Motif
Pfam: AbLIM_anchor LIM VHP ADD_ATRX
Other DBs
NCBI-GeneID: 84448
NCBI-ProteinID: NP_001123556
OMIM: 612544
HGNC: 19195
Ensembl: ENSG00000163995
Vega: OTTHUMG00000057427
Pharos: Q6H8Q1(Tdark)
UniProt: Q6H8Q1
Structure
PDB: 
2L3X 1WIG 1V6G

Position
4p16.1
AA seq 611 aa
MSAVSQPQAAPSPLEKSPSTAILCNTCGNVCKGEVLRVQDKYFHIKCFVCKACGCDLAEG
GFFVRQGEYICTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGD
RVTFNGKECMCQKCSLPVSVGSSAHLSQGLRSCGGCGTEIKNGQALVALDKHWHLGCFKC
KSCGKLLNAEYISKDGLPYCEADYHAKFGIRCDSCEKYITGRVLEAGEKHYHPSCALCVR
CGQMFAEGEEMYLQGSSIWHPACRQAARTEDRNKETRTSSESIISVPASSTSGSPSRVIY
AKLGGEILDYRDLAALPKSKAIYDIDRPDMISYSPYISHSAGDRQSYGEGDQDDRSYKQC
RTSSPSSTGSVSLGRYTPTSRSPQHYSRPGSESGRSTPSLSVLSDSKPPPSTYQQAPRHF
HVPDTGVKDNIYRKPPIYRQHAARRSDGEDGSLDQDNRKKSSWLMLKGDADTRTNSPDLD
TQSLSHSSGTDRDPLQRMAGDSFHSRFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDAS
WGMREYKIYPYDSLIVTNRIRVKLPKDVDRTRLERHLSPEEFQEVFGMSIEEFDRLALWK
RNDLKKKALLF
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgagtgcagtgtcgcagccccaggctgctcccagcccgctggagaagtcgcccagcacg
gcgatcctgtgcaacacgtgtgggaatgtgtgcaagggcgaggtgctgcgggtgcaggac
aagtacttccacatcaagtgcttcgtctgtaaagcatgtggctgcgacctggccgagggc
ggcttcttcgtgcggcagggcgagtacatctgcacgctggactaccagaggctctacggc
acccgctgcttcagctgcgaccagttcattgagggtgaggtggtgtcggcgctgggcaag
acctaccaccccgactgcttcgtgtgtgccgtctgccggctgcccttcccccccggggac
cgagtgaccttcaacgggaaggaatgcatgtgccagaagtgttccctgcccgtatcggtg
ggcagcagcgcgcacctgtcccagggcctccgaagttgtgggggctgcggcacagaaatc
aagaatggccaggccctggtagccttggacaagcactggcacttgggctgttttaagtgc
aagagctgtgggaagctcctgaatgccgagtacatcagcaaggatgggctgccctactgc
gaagctgactatcacgccaagttcggcatccgctgtgacagctgtgagaaatacatcacg
gggcgcgtgctggaggccggagagaagcactaccacccttcctgcgcgctatgtgtcagg
tgcggccagatgtttgcagaaggcgaagagatgtatcttcaaggttcctccatctggcat
ccggcgtgtcgacaagcagccagaactgaagacagaaacaaggaaaccagaacttcctca
gagagcatcatttctgtccctgcttccagcacctcagggtctccgagccgtgtgatttat
gccaagcttggtggtgagatcctggactacagggacttggcagcccttcctaaaagtaag
gccatctatgacatcgaccgccccgacatgatctcctactcaccctacatcagccactct
gcaggggacaggcagagctacggcgagggggatcaggatgaccggtcctacaagcagtgt
cggacctccagcccaagctccactgggtcggttagcctcgggcgctacactccgacctca
cggtcaccacagcactacagccgtccaggcagtgaaagtggccggagcacccccagcctc
tccgtgctctctgacagcaagccgcccccctccacctaccagcaggcacctcgccacttc
cacgtcccagacactggcgtaaaagataacatctataggaaaccccctatctacagacag
catgctgccaggcgatcggatggggaggatggaagcttggaccaggataacaggaagaag
agcagctggctgatgctcaagggggatgcagacacaaggaccaattctccagacctggac
acccagtccttgtcccacagcagcgggaccgacagagaccctctccaaaggatggcaggg
gacagctttcactcacgattcccctattccaaatctgaccctctcccaggacatggaaag
aatggcttggaccagcggaatgccaatctggccccctgtggagcagacccggatgccagc
tggggcatgcgagaatacaagatctatccgtatgactccctcatcgtcacaaaccgaatt
cgcgtgaaactgcccaaagacgtggaccggacgagactggagagacacttgtcgcccgag
gagttccaggaagtgtttgggatgagcatcgaggagtttgaccgcctggccctctggaag
aggaatgaccttaagaagaaagcccttttgttctga

DBGET integrated database retrieval system