KEGG   Homo sapiens (human): 22887Help
Entry
22887             CDS       T01001                                 

Gene name
FOXJ3
Definition
(RefSeq) forkhead box J3
  KO
K09403  forkhead box protein J2/3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    22887 (FOXJ3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix other regulators
    22887 (FOXJ3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead
Motif
Other DBs
NCBI-GeneID: 22887
NCBI-ProteinID: NP_001185779
OMIM: 616035
HGNC: 29178
Ensembl: ENSG00000198815
Vega: OTTHUMG00000007026
Pharos: Q9UPW0(Tbio)
UniProt: Q9UPW0
Position
1p34.2
AA seq 622 aa AA seqDB search
MGLYGQACPSVTSLRMTSELESSLTSMDWLPQLTMRAAIQKSDATQNAHGTGISKKNALL
DPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGS
GWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDVLPTRPKKRARSVERASTP
YSIDSDSLGMECIISGSASPTLAINTVTNKVTLYNTDQDGSDSPRSSLNNSLSDQSLASV
NLNSVGSVHSYTPVTSHPESVSQSLTPQQQPQYNLPERDKQLLFSEYNFEDLSASFRSLY
KSVFEQSLSQQGLMNIPSESSQQSHTSCTYQHSPSSTVSTHPHSNQSSLSNSHGSGLNTT
GSNSVAQVSLSHPQMHTQPSPHPPHRPHGLPQHPQRSPHPAPHPQQHSQLQSPHPQHPSP
HQHIQHHPNHQHQTLTHQAPPPPQQVSCNSGVSNDWYATLDMLKESCRIASSVNWSDVDL
SQFQGLMESMRQADLKNWSLDQVQFADLCSSLNQFFTQTGLIHSQSNVQQNVCHGAMHPT
KPSQHIGTGNLYIDSRQNLPPSVMPPPGYPHIPQALSTPGTTMAGHHRAMNQQHMMPSQA
FQMRRSLPPDDIQDDFDWDSIV
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgtatggacaggcttgtccatctgtaacttcattaaggatgacatctgaactg
gagagcagcctaacgtctatggactggttaccacagctcaccatgagagcagccatccaa
aaatctgatgctacacaaaatgcacatggaacaggaatttctaagaagaatgcactcctt
gacccaaatacaactctggaccaggaagaagtccaacagcacaaagatgggaaacctcca
tacagttatgccagcctcattacatttgcaattaatagctcacccaaaaagaaaatgact
ttaagtgaaatttatcagtggatttgtgataacttcccatattatagagaggctggcagt
ggttggaagaattccatacgacataatctgtcattgaacaaatgtttccttaaagtgcct
cgatctaaggatgaccctggaaaggggtcctactgggcaatagacaccaatccgaaggaa
gatgtgctgcctactcggccaaagaagagggcacgatctgtagaacgggcctcaactcca
tatagcatagattcagattctttgggaatggagtgtattatttcgggaagtgcctctcca
actctggcaatcaacactgtgactaacaaagtaacattgtataacactgatcaggatggt
agtgatagcccacgcagtagccttaacaacagtctctcagaccagagtttggcatctgtt
aatttgaacagtgttggaagtgtgcatagttatacaccggtgacaagccatccagaatca
gtctctcaatcattaactcctcagcagcaaccacagtacaaccttccagaaagagacaag
caactacttttctcagaatataattttgaagatcttagtgcctcatttcggagcctttat
aagtcagtttttgagcagtcacttagtcaacaaggtttgatgaacatcccttctgaatct
tcccagcagtcccacacttcatgtacctatcagcactctcccagcagtacagtgagcact
cacccacacagcaaccaaagcagcctgtccaacagtcatggcagtggcctcaacaccaca
ggcagtaattcggttgcacaggtctcactgtctcacccccagatgcacacacagccatct
ccacatcctccccatcgaccgcatggtttaccgcagcatccgcagcgttccccacaccca
gcaccacacccacagcaacacagccagctccagtcccctcacccccagcatccctctcca
catcaacacatacagcaccatccgaaccatcagcatcagacgttaacacatcaggcaccc
ccacccccacaacaggtatcctgtaattctggtgtttcaaatgattggtatgcgacactt
gatatgctaaaagaaagctgtcgaattgccagcagtgttaattggtcagatgtagacctt
tcacagtttcaaggtctgatggagagtatgagacaggcagatctcaagaactggtcttta
gaccaggttcagtttgccgatctttgttcttctcttaatcagttctttacacaaactggc
cttatacattcacagagtaatgttcaacaaaatgtttgtcatggtgccatgcatccaaca
aaaccttcccaacacattggaacaggaaatttgtacatagattctaggcaaaatctccct
ccttcagtgatgccaccccctggttatcctcatatcccacaggcactcagcactccagga
acaacgatggcaggccatcacagagccatgaaccagcagcacatgatgccttcccaagcc
ttccagatgcggcgttccctgcctccagatgacatccaggatgactttgattgggattca
attgtgtag

DBGET integrated database retrieval system