KEGG   Homo sapiens (human): 22895Help
Entry
22895             CDS       T01001                                 

Gene name
RPH3A
Definition
(RefSeq) rabphilin 3A
  KO
K19938  rabphilin-3A
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    22895 (RPH3A)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    22895 (RPH3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 FYVE_2 zf-piccolo PI3K_C2 OmpH
Motif
Other DBs
NCBI-GeneID: 22895
NCBI-ProteinID: NP_001137326
OMIM: 612159
HGNC: 17056
Ensembl: ENSG00000089169
Vega: OTTHUMG00000169713
Pharos: Q9Y2J0(Tbio)
UniProt: Q9Y2J0
Position
12q24.13
AA seq 694 aa AA seqDB search
MTDTVFSNSSNRWMYPSDRPLQSNDKEQLQAGWSVHPGGQPDRQRKQEELTDEEKEIINR
VIARAEKMEEMEQERIGRLVDRLENMRKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKK
NVCTKCGVETNNRLHSVWLCKICIEQREVWKRSGAWFFKGFPKQVLPQPMPIKKTKPQQP
VSEPAAPEQPAPEPKHPARAPARGDSEDRRGPGQKTGPDPASAPGRGNYGPPVRRASEAR
MSSSSRDSESWDHSGGAGDSSRSPAGLRRANSVQASRPAPGSVQSPAPPQPGQPGTPGGS
RPGPGPAGRFPDQKPEVAPSDPGTTAPPREERTGGVGGYPAVGAREDRMSHPSGPYSQAS
AAAPQPAAARQPPPPEEEEEEANSYDSDEATTLGALEFSLLYDQDNSSLQCTIIKAKGLK
PMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNETLVYHGITDEDMQRKTLRI
SVCDEDKFGHNEFIGETRFSLKKLKPNQRKNFNICLERVIPMKRAGTTGSARGMALYEEE
QVERVGDIEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGK
KAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISA
KGERLKHWYECLKNKDKKIERWHQLQNENHVSSD
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaccgtgttcagcaacagttctaaccgttggatgtaccccagtgaccggccc
cttcaatcaaatgataaagaacagctccaggcaggctggtccgtccaccccggtggtcag
cctgacaggcagaggaagcaggaagagctgactgatgaggagaaagaaatcatcaacagg
gtgattgctcgagctgagaaaatggaagagatggagcaggagcgaatcggacgcctggtg
gaccgcctagaaaacatgaggaagaacgtggctggagatggggtgaaccgctgcatactg
tgtggagaacagctggggatgctgggctctgcctgtgtagtatgtgaggactgtaagaag
aacgtctgcaccaagtgcggagtggagaccaacaaccgcctgcattctgtgtggctctgc
aaaatctgcattgagcagagggaggtgtggaagcgttctggagcgtggttcttcaaaggc
ttccccaaacaggtcctcccacagcctatgcctataaagaagaccaagccccagcagcct
gtcagtgagcctgctgcccctgaacagcctgctcctgagcccaagcaccctgcccgggct
ccagctcgaggtgacagtgaagataggaggggcccgggtcagaagacaggccctgaccca
gcctctgctcccgggcgaggaaactatgggcctcccgtgcgcagggcctccgaggcacga
atgagctcatctagccgagattcagagagctgggaccacagtgggggtgctggagactcc
agccggagcccagcaggtttgagacgggccaactcagtccaggcctccagacctgcccca
ggctcggtgcagagcccagcgccacctcagcctgggcagccagggaccccaggaggaagc
agaccgggtcctgggccagcaggacgctttccagatcagaagccagaggtggctccgagc
gaccctgggaccactgccccaccccgagaggagagaacagggggagtcgggggctaccca
gcagttggagccagagaggaccgaatgagccacccctccggaccctattcccaagcatct
gcagctgccccccagcctgctgcagcccgccagccaccacccccagaggaggaggaagag
gaagccaacagctacgattcggatgaagcaaccaccctgggtgccctggaattcagcctt
ctctacgaccaggacaacagctccctgcagtgcaccatcattaaggccaagggcctgaag
cccatggattcaaacggcttggctgatccctacgttaagctgcacctcctgccgggagcc
agcaagtccaacaagcttcgtacaaaaactctgcggaatacccggaaccccatctggaat
gagaccctcgtgtatcacggcatcaccgatgaggacatgcaaaggaagaccctcaggatc
tccgtctgtgatgaggacaaatttggccacaatgaatttattggtgagaccagattctcc
ctcaagaaactgaagcccaaccagaggaagaatttcaacatctgcctggagcgagtgatt
cctatgaaacgtgctgggaccaccgggtcagcccgaggcatggccctttatgaggaagag
caggtggagcgtgttggtgacatcgaggagcgtggcaagatcctggtctccctcatgtac
agcacacagcagggaggcctcattgtgggcatcatacgctgcgtgcacctggctgccatg
gacgctaatggctactcagacccattcgtcaagctctggctgaaaccggacatgggaaag
aaggccaaacacaagactcaaattaaaaagaaaaccttgaatcccgaattcaatgaggag
tttttctatgacatcaaacacagtgacctggcaaagaagtcactggacatttcagtctgg
gactatgacatcggcaagtccaatgattacatcggaggctgccagctggggatctctgcc
aagggagagcgcttaaaacactggtacgagtgtctgaaaaataaagacaagaagatagag
cgctggcaccagctacagaatgagaaccacgtgtcaagtgattag

DBGET integrated database retrieval system