KEGG   Homo sapiens (human): 22899
Entry
22899             CDS       T01001                                 
Symbol
ARHGEF15, ARGEF15, E5, Ephexin5, Vsm-RhoGEF
Name
(RefSeq) Rho guanine nucleotide exchange factor 15
  KO
K20687  Rho guanine nucleotide exchange factor 15
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    22899 (ARHGEF15)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    22899 (ARHGEF15)
SSDB
Motif
Pfam: RhoGEF PH
Other DBs
NCBI-GeneID: 22899
NCBI-ProteinID: NP_079290
OMIM: 608504
HGNC: 15590
Ensembl: ENSG00000198844
Pharos: O94989(Tdark)
UniProt: O94989 A0A0S2Z547
Position
17:8310241..8322511
AA seq 841 aa
MSAQSLPAATPPTQKPPRIIRPRPPSRSRAAQSPGPPHNGSSPQELPRNSNDAPTPMCTP
IFWEPPAASLKPPALLPPSASRASLDSQTSPDSPSSTPTPSPVSRRSASPEPAPRSPVPP
PKPSGSPCTPLLPMAGVLAQNGSASAPGTVRRLAGRFEGGAEGRAQDADAPEPGLQARAD
VNGEREAPLTGSGSQENGAPDAGLACPPCCPCVCHTTRPGLELRWVPVGGYEEVPRVPRR
ASPLRTSRSRPHPPSIGHPAVVLTSYRSTAERKLLPLLKPPKPTRVRQDATIFGDPPQPD
LDLLSEDGIQTGDSPDEAPQNTPPATVEGREEEGLEVLKEQNWELPLQDEPLYQTYRAAV
LSEELWGVGEDGSPSPANAGDAPTFPRPPGPRNTLWQELPAVQASGLLDTLSPQERRMQE
SLFEVVTSEASYLRSLRLLTDTFVLSQALRDTLTPRDHHTLFSNVQRVQGVSERFLATLL
SRVRSSPHISDLCDVVHAHAVGPFSVYVDYVRNQQYQEETYSRLMDTNVRFSAELRRLQS
LPKCERLPLPSFLLLPFQRITRLRMLLQNILRQTEEGSSRQENAQKALGAVSKIIERCSA
EVGRMKQTEELIRLTQRLRFHKVKALPLVSWSRRLEFQGELTELGCRRGGVLFASRPRFT
PLCLLLFSDLLLITQPKSGQRLQVLDYAHRSLVQAQQVPDPSGPPTFRLSLLSNHQGRPT
HRLLQASSLSDMQRWLGAFPTPGPLPCSPDTIYEDCDCSQELCSESSAPAKTEGRSLESR
AAPKHLHKTPEGWLKGLPGAFPAQLVCEVTGEHERRRHLRQNQRLLEAVGSSSGTPNAPP
P
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgtcagcccagtcccttcctgcagcaacaccccccacgcagaagccccctcggatcatc
cgcccccgccctccttctcgttccagggctgcccagtccccagggcctccccacaatggc
tcctctccacaagaactaccccgaaactccaatgatgcaccaaccccaatgtgcaccccc
atcttctgggagcccccagctgcatccctcaagccccctgctcttttgcccccctcagct
tctagagccagcctcgactcccagacttccccagactcaccttccagcacccccacacct
agtccagtgtcccggcgctccgcctccccagaacctgctccccggtctccagtcccccca
cccaagccgtctgggtcaccctgcacgcctctgctccccatggctggagtcctggctcag
aatggctctgcctcagctcctggcactgtgcggaggctggctggcaggtttgaagggggt
gctgaaggccgggctcaggatgcagatgccccggagccaggtctccaagcgagagcagat
gtgaatggggagagagaagctcccctcaccgggagtgggtcccaggagaacggtgctcca
gatgctggcctggcctgccctccctgctgcccctgtgtctgccacaccacccggcctggc
ctggagctcagatgggtgcctgtggggggctatgaggaggtccccagggtcccccgtcgg
gcctccccgctgcggacctctcgctcccgcccccaccctccaagcatcggtcaccctgcc
gttgtcctcacatcctaccgctccactgctgagcgcaaactcctgccactcctcaagcct
cccaaaccaactcgtgtcaggcaggatgccaccattttcggggaccccccacagccagat
cttgatctgctttctgaagatggaatccaaacaggggacagtcctgatgaagctcctcag
aatactcctccagcaactgtggaggggagggaagaggaggggctagaggtgctgaaggag
cagaattgggagctgcccctgcaggatgaacctctgtaccagacctaccgagcagccgtg
ctgtcagaggagctgtggggggtgggtgaggatgggagtccttctccagcaaatgctgga
gatgcacccaccttcccacgaccccctggacctcgcaacaccctgtggcaggagcttccg
gctgtgcaagccagcggtcttctggataccctcagcccccaggagaggcgcatgcaggag
agtcttttcgaggtggtgacgtccgaggcttcctacctgcgctccctgcggctgctgacc
gacaccttcgtgctgagccaggcactccgggacacgctcaccccccgtgatcaccacaca
ctcttctccaatgtgcagcgagtccagggagtcagcgagcggtttctagcaacgctcctg
tcccgtgtgcgctcttccccccacatcagcgacttgtgtgatgtggtgcatgcccacgct
gtggggcctttctcggtgtatgtggattatgtgcggaaccagcagtatcaggaggagacc
tacagccgcctcatggacaccaacgtgcgcttctccgccgagctgcgccggctgcagagc
ctccctaagtgtgagcggctcccgctgccgtccttcctgctactgcccttccagcgcatc
acccggctgcgcatgctgctgcagaatatcctgcgccagacagaagaggggtccagccgt
caggagaatgcccagaaggccctgggtgctgtcagcaagatcatcgagcgttgcagcgct
gaggtggggcgcatgaagcagactgaagagctgatccggctcacccaaaggctgcgcttc
cacaaagtcaaggccctgcccctggtctcctggtcacggcgcctggaattccagggagag
ctgactgagttagggtgccggagggggggcgtgctctttgcctcgcgcccccgcttcacc
cctctttgcctgctgctctttagcgacctgctgctcatcactcagcctaagagtgggcag
cggttacaggttctggactatgcccatcgctccctggtccaggcccagcaggttccggat
ccatctggaccccctaccttccgcctctcccttctcagcaaccaccagggccgccccacc
caccgactactccaagcttcttccctatcagacatgcagcgctggctgggagccttccca
accccaggcccccttccctgctccccagacaccatctatgaggactgtgactgttcccag
gaactgtgttcagagtcgtctgcacctgccaagactgaaggacggagtctggagtccagg
gctgcccccaaacacctgcacaagacccctgaaggttggctgaaggggcttcctggggcc
ttccctgcccagctggtgtgtgaagtcacaggggaacacgaaaggaggaggcaccttcgc
cagaaccagaggcttctcgaggctgttggatcttcttcaggcacccccaatgccccccca
ccctaa

DBGET integrated database retrieval system