KEGG   Homo sapiens (human): 22900
Entry
22900             CDS       T01001                                 
Symbol
CARD8, CARDINAL, DACAR, DAKAR, NDPP, NDPP1, TUCAN
Name
(RefSeq) caspase recruitment domain family member 8
  KO
K12801  caspase recruitment domain-containing protein 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Network
nt06521  NLR signaling
  Element
N01568  Regulation of NLRP3 inflammasome signaling pathway, NLRP3 inhibition
Disease
H01227  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    22900 (CARD8)
SSDB
Motif
Pfam: FIIND CARD
Other DBs
NCBI-GeneID: 22900
NCBI-ProteinID: NP_001171829
OMIM: 609051
HGNC: 17057
Ensembl: ENSG00000105483
Pharos: Q9Y2G2(Tbio)
UniProt: Q9Y2G2
Structure
Position
19:complement(48179825..48255946)
AA seq 537 aa
MEKKECPEKSSSSEEELPRRDSGSSRNIDASKLIRLQGSRKLLVDNSIRELQYTKTGIFF
QAEACVTNDTVYRELPCVSETLCDISHFFQEDDETEAEPLLFRAVPECQLSGGDIPSVSE
EQESSEGQDSGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELIDKSTNRY
SVWFPTAGWYLWSATGLGFLVRDEVTVTIAFGSWSQHLALDLQHHEQWLVGGPLFDVTAE
PEEAVAEIHLPHFISLQAGEVDVSWFLVAHFKNEGMVLEHPARVEPFYAVLESPSFSLMG
ILLRIASGTRLSIPITSNTLIYYHPHPEDIKFHLYLVPSDALLTKAIDDEEDRFHGVRLQ
TSPPMEPLNFGSSYIVSNSANLKVMPKELKLSYRSPGEIQHFSKFYAGQMKEPIQLEITE
KRHGTLVWDTEVKPVDLQLVAASAPPPFSGAAFVKENHRQLQARMGDLKGVLDDLQDNEV
LTENEKELVEQEKTRQSKNEALLSMVEKKGDLALDVLFRSISERDPYLVSYLRQQNL
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggaaaaaaaggagtgtccagaaaagagtagcagcagtgaggaagagctgccgagacgg
gacagtggatccagtaggaacatagatgcatccaaactcattagactacaaggatcacgg
aaactgttggttgacaatagcatacgggaactgcaatacacaaaaactggaatttttttt
caggctgaggcctgtgtgacaaatgatacggtatacagggagctaccctgtgtttctgag
accctttgtgacatctcacattttttccaagaagatgatgagacagaggcagagccatta
ttgttccgtgctgttcctgagtgtcaactatctgggggggacattcccagtgtatcagaa
gagcaggaatcttcagagggacaagattcaggagacatttgctcagaagagaatcaaata
gtttcctcttatgcttctaaagtctgttttgagatcgaagaagattataaaaatcgtcag
tttctggggcctgaaggaaatgtggatgttgagttgattgataagagcacaaacagatac
agcgtttggttccccactgctggctggtatctgtggtcagccacaggcctcggcttcctg
gtaagggatgaggtcacagtgacgattgcgtttggttcctggagtcagcacctggccctg
gacctgcagcaccatgaacagtggctggtgggcggccccttgtttgatgtcactgcagag
ccagaggaggctgtcgccgaaatccacctcccccacttcatctccctccaagcaggtgag
gtggacgtctcctggtttctcgttgcccattttaagaatgaagggatggtcctggagcat
ccagcccgggtggagcctttctatgctgtcctggaaagccccagcttctctctgatgggc
atcctgctgcggatcgccagtgggactcgcctctccatccccatcacttccaacacattg
atctattatcacccccaccccgaagatattaagttccacttgtaccttgtccccagcgac
gccttgctaacaaaggcgatagatgatgaggaagatcgcttccatggtgtgcgcctgcag
acttcgcccccaatggaacccctgaactttggttccagttatattgtgtctaattctgct
aacctgaaagtaatgcccaaggagttgaaattgtcctacaggagccctggagaaattcag
cacttctcaaaattctatgctgggcagatgaaggaacccattcaacttgagattactgaa
aaaagacatgggactttggtgtgggatactgaggtgaagccagtggatctccagcttgta
gctgcatcagcccctcctcctttctcaggtgcagcctttgtgaaggagaaccaccggcaa
ctccaagccaggatgggggacctgaaaggggtgctcgatgatctccaagacaatgaggtt
cttactgagaatgagaaggagctggtggagcaggaaaagacacggcagagcaagaatgag
gccttgctgagcatggtggagaagaaaggggacctggccctggacgtgctcttcagaagc
attagtgaaagggacccttacctcgtgtcctatcttagacagcagaatttgtaa

DBGET integrated database retrieval system