KEGG   Homo sapiens (human): 22906Help
Entry
22906             CDS       T01001                                 

Gene name
TRAK1, MILT1, OIP106
Definition
(RefSeq) trafficking kinesin protein 1
  KO
K15369  trafficking kinesin-binding protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    22906 (TRAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAP1_N Milton KASH_CCD ATG16
Motif
Other DBs
NCBI-GeneID: 22906
NCBI-ProteinID: NP_001036111
OMIM: 608112
HGNC: 29947
Ensembl: ENSG00000182606
Vega: OTTHUMG00000131795
Pharos: Q9UPV9(Tbio)
UniProt: Q9UPV9 A0A024R2M0
Position
3p22.1
AA seq 953 aa AA seqDB search
MALVFQFGQPVRAQPLPGLCHGKLIRTNACDVCNSTDLPEVEIISLLEEQLPHYKLRADT
IYGYDHDDWLHTPLISPDANIDLTTEQIEETLKYFLLCAERVGQMTKTYNDIDAVTRLLE
EKERDLELAARIGQSLLKKNKTLTERNELLEEQVEHIREEVSQLRHELSMKDELLQFYTS
AAEESEPESVCSTPLKRNESSSSVQNYFHLDSLQKKLKDLEEENVVLRSEASQLKTETIT
YEEKEQQLVNDCVKELRDANVQIASISEELAKKTEDAARQQEEITHLLSQIVDLQKKAKA
CAVENEELVQHLGAAKDAQRQLTAELRELEDKYAECMEMLHEAQEELKNLRNKTMPNTTS
RRYHSLGLFPMDSLAAEIEGTMRKELQLEEAESPDITHQKRVFETVRNINQVVKQRSLTP
SPMNIPGSNQSSAMNSLLSSCVSTPRSSFYGSDIGNVVLDNKTNSIILETEAADLGNDER
SKKPGTPGTPGSHDLETALRRLSLRRENYLSERRFFEEEQERKLQELAEKGELRSGSLTP
TESIMSLGTHSRFSEFTGFSGMSFSSRSYLPEKLQIVKPLEGSATLHHWQQLAQPHLGGI
LDPRPGVVTKGFRTLDVDLDEVYCLNDFEEDDTGDHISLPRLATSTPVQHPETSAHHPGK
CMSQTNSTFTFTTCRILHPSDELTRVTPSLNSAPTPACGSTSHLKSTPVATPCTPRRLSL
AESFTNTRESTTTMSTSLGLVWLLKERGISAAVYDPQSWDRAGRGSLLHSYTPKMAVIPS
TPPNSPMQTPTSSPPSFEFKCTSPPYDNFLASKPASSILREVREKNVRSSESQTDVSVSN
LNLVDKVRRFGVAKVVNSGRAHVPTLTEEQGPLLCGPPGPAPALVPRGLVPEGLPLRCPT
VTSAIGGLQLNSGIRRNRSFPTMVGSSMQMKAPVTLTSGILMGAKLSKQTSLR
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atggcattggtttttcaattcgggcagcccgtcagggctcagcctctgccaggactctgc
cacggcaagctcattcggacaaacgcctgtgatgtgtgcaacagcaccgatcttccggaa
gtcgagatcattagcctgctggaggagcagctgccccattataagttaagagccgacacc
atctacggttatgaccacgacgactggctccatacacctctcatttctccagatgccaac
attgacctcacaaccgagcaaattgaagagacgttaaaatacttccttttatgtgctgaa
agagttggccagatgactaagacatataatgacatagatgctgtcactcggcttcttgag
gagaaagagcgggatttagaattggccgctcgcatcggccagtcgttgttgaagaagaac
aagaccctaaccgagaggaacgagctgctggaggagcaggtggaacacatcagggaggag
gtgtctcagctccggcatgagctgtccatgaaggatgagctgcttcagttctacaccagc
gctgcggaggagagtgagcccgagtccgtttgctcaaccccgttgaagaggaatgagtcg
tcctcctcagtccagaattactttcatttggattctcttcaaaagaagctgaaagacctt
gaagaggagaatgttgtacttcgatccgaggccagccagctgaagacagagaccatcacc
tatgaggagaaggagcagcagctggtcaatgactgcgtgaaggagctgagggatgccaat
gtccagattgctagtatctcagaggaactggccaagaagacggaagatgctgcccgccag
caagaggagatcacacacctgctatcgcaaatagttgatttgcagaaaaaggcaaaagct
tgcgcagtggaaaatgaagaacttgtccagcatctgggggctgctaaggatgcccagcgg
cagctcacagccgagctgcgtgagctggaggacaagtacgcagagtgcatggagatgctg
catgaggcgcaggaggagctgaagaacctccggaacaaaaccatgcccaataccacgtct
cggcgctaccactcactgggcctgtttcccatggattccttggcagcagagattgaggga
acgatgcgcaaggagctgcagttggaagaggccgagtctccagacatcactcaccagaag
cgtgtctttgagacagtaagaaacatcaaccaggttgtcaagcagagatctctgacccct
tctcccatgaacatccccggctccaaccagtcctcggccatgaactccctcctgtccagc
tgcgtcagcaccccccggtccagcttctacggcagcgacataggcaacgtcgtcctcgac
aacaagaccaacagcatcattctggaaacagaggcagccgacctgggaaacgatgagcgg
agtaagaagccggggacgccgggcaccccaggctcccacgacctggagacggcgctgagg
cggctgtccctgcgccgggagaactacctctcggagaggaggttctttgaggaggagcaa
gagaggaagctccaggagctggcggagaagggcgagctgcgcagcggctccctcacaccc
actgagagcatcatgtccctgggcacgcactcccgcttctccgagttcaccggcttctct
ggcatgtccttcagcagccgctcctacctgcctgagaagctccagatcgtgaagccgctg
gaaggttccgccacacttcaccactggcagcagttggcccaacctcaccttgggggcatc
ctggacccccggcccggtgtggtcaccaagggcttccggacgctggatgttgacctggac
gaagtgtactgccttaacgactttgaagaagatgacacaggtgaccacatttctctccca
cgcctagctacctccactccagttcagcacccagagacctcagcgcaccatcctgggaag
tgcatgtctcagaccaactccaccttcaccttcaccacctgtcgcatcctgcatccttca
gatgagctcactcgggtcacaccaagccttaactcagccccaactccagcttgtggcagc
accagccacttgaaatccacgccggtggccacaccatgcactccacggagactgagcctg
gctgagtccttcactaacacccgtgagtccacgaccaccatgagcacatccctggggctc
gtgtggctgttgaaggagcggggcatttctgctgccgtgtacgacccccagagctgggac
agggccggccggggctccctcctgcactcctacacgcccaagatggctgtgatcccctct
actccgccgaactcgcctatgcagacacccacatcctccccaccctcctttgagttcaag
tgcacgagccctccctacgacaatttcctggcttccaagccagccagctccatcctgagg
gaagtgagagaaaagaacgtccgcagcagcgagagccagaccgacgtgtccgtctccaac
ctcaacctcgtggacaaagtcaggaggtttggggtggccaaagtggtgaactcagggcga
gcccatgtccccaccttgactgaggagcagggacccctcctctgtgggcccccggggcca
gcaccagcccttgttcccagaggcctggtacctgagggcctgcccctcagatgccccact
gtcaccagtgccatcggtgggctgcagctcaatagtggcatccggcggaatcgcagcttc
cccaccatggtgggatctagcatgcagatgaaagctcctgtgactctcacctcgggcatc
ttgatgggtgctaagctctccaaacaaactagcttacggtga

DBGET integrated database retrieval system