KEGG   Homo sapiens (human): 22908Help
Entry
22908             CDS       T01001                                 

Gene name
SACM1L, SAC1
Definition
(RefSeq) SAC1 like phosphatidylinositide phosphatase
  KO
K21797  phosphatidylinositol 4-phosphatase [EC:3.1.3.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    22908 (SACM1L)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    22908 (SACM1L)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     22908 (SACM1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syja_N DSS1_SEM1
Motif
Other DBs
NCBI-GeneID: 22908
NCBI-ProteinID: NP_054735
OMIM: 606569
HGNC: 17059
Ensembl: ENSG00000211456
Vega: OTTHUMG00000156653
Pharos: Q9NTJ5(Tbio)
UniProt: Q9NTJ5
Position
3p21.31
AA seq 587 aa AA seqDB search
MATAAYEQLKLHITPEKFYVEACDDGADDVLTIDRVSTEVTLAVKKDVPPSAVTRPIFGI
LGTIHLVAGNYLIVITKKIKVGEFFSHVVWKATDFDVLSYKKTMLHLTDIQLQDNKTFLA
MLNHVLNVDGFYFSTTYDLTHTLQRLSNTSPEFQEMSLLERADQRFVWNGHLLRELSAQP
EVHRFALPVLHGFITMHSCSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVET
EQIVHYNGSKASFVQTRGSIPVFWSQRPNLKYKPLPQISKVANHMDGFQRHFDSQVIIYG
KQVIINLINQKGSEKPLEQTFATMVSSLGSGMMRYIAFDFHKECKNMRWDRLSILLDQVA
EMQDELSYFLVDSAGQVVANQEGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHV
GQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTHLGLIMDGWNSMIR
YYKNNFSDGFRQDSIDLFLGNYSVDELESHSPLSVPRDWKFLALPIIMVVAFSMCIICLL
MAGDTWTETLAYVLFWGVASIGTFFIILYNGKDFVDAPRLVQKEKID
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggcggcctacgagcagctgaagctgcatatcacacctgaaaaattttatgtg
gaagcttgtgatgatggagcagatgacgtacttaccattgaccgtgtgtccacagaggtt
acccttgcagtcaagaaagatgttcctccttcagctgtcacaagaccaatatttggtata
ctgggcacaatccatctggtggcaggtaattatcttatagtcattaccaaaaagataaaa
gtaggtgaatttttcagtcatgtagtctggaaagcaacagattttgatgtcctttcttat
aagaagacaatgttgcacttaactgatattcagttacaagataataaaaccttcctagcg
atgctaaaccatgtcttgaatgtggatggattttacttttcaacaacatatgatttgacc
catactttgcagcggctatccaacactagtcctgaattccaagaaatgagtctcttggaa
agggcagatcagcggtttgtatggaatggtcatcttctaagagaactttctgcacagcca
gaggttcatcggtttgcccttccagtgttacatggctttattaccatgcattcatgttct
attaatggaaaatactttgattggattctcatctcgaggaggagctgtttcagagctggt
gtgcgctattatgtaagaggaattgattcggaaggccatgcagctaactttgtagaaaca
gaacaaattgtgcactacaatgggagcaaagcttcgtttgtacagactcgaggatcaata
cctgttttctggtcccaaagaccaaacctcaagtacaaaccactgccacagatcagcaaa
gtagcaaatcacatggacggtttccaaaggcattttgattcccaagtaattatttatgga
aaacaagttataatcaatctgattaaccagaagggctcggagaagccacttgagcagaca
tttgcaacaatggtgtcttccttgggaagtggaatgatgagatacattgcctttgacttc
cataaggaatgtaaaaatatgagatgggatcgactaagtattttattggatcaggtagca
gaaatgcaagatgaattaagttattttctagtggactctgctggccaggtggtggcaaac
caggaaggcgtgttccgaagcaattgcatggattgtctagatagaaccaatgtgatccag
agtttgttagctcgtcgttcacttcaggcccaacttcagagactaggagttttgcatgtg
ggacaaaagcttgaagaacaagatgaatttgagaagatttacaaaaatgcctgggctgac
aacgcaaatgcttgtgccaagcaatatgcgggaactggtgccttgaagactgactttacc
agaactggaaagagaactcatttgggacttataatggatggctggaactcaatgatacga
tattataagaacaacttttccgatggatttagacaagattccatagacttatttcttgga
aactattcagtggatgaattagaatctcatagtcctttaagtgttccaagggactggaaa
ttcctggctttgcctattatcatggttgttgccttttcaatgtgcattatctgtttgctt
atggctggtgacacttggacagaaacactggcctatgtgctcttctggggagttgcaagc
attggaacattttttatcattctttacaatggcaaagattttgtcgatgctcccagactg
gtccagaaagaaaagatagactga

DBGET integrated database retrieval system