KEGG   Homo sapiens (human): 22916Help
Entry
22916             CDS       T01001                                 

Gene name
NCBP2, CBC2, CBP20, NIP1, PIG55
Definition
(RefSeq) nuclear cap binding protein subunit 2
  KO
K12883  nuclear cap-binding protein subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
hsa03040  Spliceosome
Module
hsa_M00399  Cap binding complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    22916 (NCBP2)
  Translation
   03013 RNA transport
    22916 (NCBP2)
   03015 mRNA surveillance pathway
    22916 (NCBP2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA processing factors
   5' end processing
    Cap binding complex
     22916 (NCBP2)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   Cap binding complex
    22916 (NCBP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_occluded RRM_5 DUF4279
Motif
Other DBs
NCBI-GeneID: 22916
NCBI-ProteinID: NP_031388
OMIM: 605133
HGNC: 7659
Ensembl: ENSG00000114503
Vega: OTTHUMG00000155520
Pharos: P52298(Tbio)
UniProt: P52298
Structure
PDB: 

Position
3q29
AA seq 156 aa AA seqDB search
MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELF
SKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFK
EGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtggcctcctgaaggcgctgcgcagcgactcctacgtggagctgagccagtac
cgggaccagcacttccggggtgacaatgaagaacaagaaaaattactgaagaaaagctgt
acgttatatgttggaaatctttctttttacacaactgaagaacaaatctatgaactcttc
agcaaaagtggtgacataaagaaaatcattatgggtctggataaaatgaagaaaacagca
tgtggattctgttttgtggaatattactcacgcgcagatgcggaaaacgccatgcggtac
ataaatgggacgcgtctggatgaccgaatcattcgcacagactgggacgcaggctttaag
gagggcaggcaatacggccgtgggcgatctgggggccaggttcgggatgagtatcggcag
gactacgatgctgggagaggaggctatggaaaactggcacagaaccagtga

DBGET integrated database retrieval system